PDB entry 3bx5

View 3bx5 on RCSB PDB site
Description: P38 alpha map kinase complexed with BMS-640994
Class: signaling protein, transferase
Keywords: serine/threonine-protein kinase, kinase, transferase, p38 map kinase, signaling protein
Deposited on 2008-01-11, released 2008-04-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-20.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.229
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, CSPB1, MXI2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3bx5a_
  • Heterogens: 304, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bx5A (A:)
    mahhhhhsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkk
    lsrpfqsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadln
    nivkcqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarh
    tddemtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlkl
    ilrlvgtpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsd
    kritaaqalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppld
    qeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bx5A (A:)
    rptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsiih
    akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltd
    dhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtrwyrapeim
    lnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkisses
    arnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdp
    ddepvadpydqsfesrdllidewksltydevisfvppp