PDB entry 3bwy

View 3bwy on RCSB PDB site
Description: Crystal Structure of Human 108M Catechol O-methyltransferase bound with S-adenosylmethionine and inhibitor dinitrocatechol
Class: transferase
Keywords: COMT, methyltransferase, polymorphism, Rossmann fold, SAM, DNC, TRANSFERASE
Deposited on 2008-01-10, released 2008-06-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: COMT protein
    Species: HOMO SAPIENS
    Gene: COMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3bwya_
  • Heterogens: MG, SAM, DNC, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bwyA (A:)
    gdtkeqrilnhvlqhaepgnaqsvleaidtyceqkewamnvgdkkgkivdaviqehqpsv
    llelgaycgysavrmarllspgarlitieinpdcaaitqrmvdfagmkdkvtlvvgasqd
    iipqlkkkydvdtldmvfldhwkdrylpdtllleecgllrkgtvlladnvicpgapdfla
    hvrgsscfecthyqsfleyrevvdglekaiykgp