PDB entry 3bwx

View 3bwx on RCSB PDB site
Description: crystal structure of an alpha/beta hydrolase (yp_496220.1) from novosphingobium aromaticivorans dsm 12444 at 1.50 a resolution
Deposited on 2008-01-10, released 2008-01-22
The last revision was dated 2021-10-20, with a file datestamp of 2021-10-15.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha/beta hydrolase
    Species: Novosphingobium aromaticivorans [TaxId:279238]
    Gene: YP_496220.1, Saro_0941
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2G9T7 (1-284)
      • leader sequence (0)
      • engineered mutation (209)
  • Heterogens: CA, CL, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3bwxA (A:)
gmaeyedrywtssdglrlhfrayegdisrppvlclpgltrnardfedlatrlagdwrvlc
pemrgrgdsdyakdpmtyqpmqylqdleallaqegierfvaigtslgglltmllaaanpa
riaaavlndvgpevspeglerirgyvgqgrnfetwmhaaralqessgdvypdwditqwlr
yakrimvlgssgriafdydmkiaepfeapvgatpqvdmwplfdalatrpllvlrgetsdi
lsaqtaakmasrpgvelvtlprighaptldepesiaaigrllerv