PDB entry 3bwu

View 3bwu on RCSB PDB site
Description: Crystal structure of the ternary complex of FimD (N-Terminal Domain, FimDN) with FimC and the N-terminally truncated pilus subunit FimF (FimFt)
Class: chaperone, structural, membrane protein
Keywords: Usher, N-terminal domain, ternary complex with chaperone and pilus subunit, CHAPERONE, STRUCTURAL PROTEIN, MEBRANE PROTEIN, STRUCTURAL, MEMBRANE PROTEIN
Deposited on 2008-01-10, released 2008-03-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: chaperone protein fimc
    Species: Escherichia coli [TaxId:83333]
    Gene: fimC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3bwuc1, d3bwuc2
  • Chain 'D':
    Compound: Outer membrane usher protein FimD, N-terminal domain
    Species: Escherichia coli [TaxId:83333]
    Gene: fimD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3bwud_
  • Chain 'F':
    Compound: Protein fimF
    Species: Escherichia coli [TaxId:83333]
    Gene: fimF
    Database cross-references and differences (RAF-indexed):
  • Heterogens: EDO, PEG, HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3bwuC (C:)
    gvalgatrviypagqkqeqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
    kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
    alppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsd
    agsnityrtindygaltpkmtgvme
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bwuC (C:)
    gvalgatrviypagqkqeqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
    kentlrildatnnqlpqdreslfwmnvkaipsmdentlqlaiisriklyyrpaklalppd
    qaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsdagsni
    tyrtindygaltpkmtgvme
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3bwuD (D:)
    dlyfnprfladdpqavadlsrfengqelppgtyrvdiylnngymatrdvtfntgdseqgi
    vpcltraqlasmglntasvagmnlladdacvplttmvqdatahldvgqqrlnltipqafm
    snrar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bwuD (D:)
    lyfnprfladdpqavadlsrfengqelppgtyrvdiylnngymatrdvtfntgdseqgiv
    pcltraqlasmglntasvagmnlladdacvplttmvqdatahldvgqqrlnltipqafms
    n
    

  • Chain 'F':
    No sequence available.