PDB entry 3bwr

View 3bwr on RCSB PDB site
Description: SV40 VP1 pentamer in complex with GM1 oligosaccharide
Class: viral protein
Keywords: SV40, GM1, viral receptor, viral attachment, ganglioside, VP1, polyomaviruses, Capsid protein, Late protein, Nucleus, Virion, VIRAL PROTEIN
Deposited on 2008-01-10, released 2008-03-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-10-05, with a file datestamp of 2011-09-30.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.192
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Capsid protein VP1
    Species: Simian virus 40 [TaxId:10633]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3bwra_
  • Chain 'B':
    Compound: Capsid protein VP1
    Species: Simian virus 40 [TaxId:10633]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3bwrb_
  • Chain 'C':
    Compound: Capsid protein VP1
    Species: Simian virus 40 [TaxId:10633]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3bwrc_
  • Chain 'D':
    Compound: Capsid protein VP1
    Species: Simian virus 40 [TaxId:10633]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3bwrd_
  • Chain 'E':
    Compound: Capsid protein VP1
    Species: Simian virus 40 [TaxId:10633]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3bwre_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bwrA (A:)
    gshmggievlgvktgvdsftevecflnpqmgnpdehqkglskslaaekqftddspdkeql
    pcysvariplpninedltcgnilmweavtvktevigvtamlnlhsgtqkthengagkpiq
    gsnfhffavggeplelqgvlanyrtkypaqtvtpknatvdsqqmntdhkavldkdnaypv
    ecwvpdpsknentryfgtytggenvppvlhitntattvlldeqgvgplckadslyvsavd
    icglftntsgtqqwkglpryfkitlrkrsvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bwrA (A:)
    gievlgvktgvdsftevecflnpqmgnpdehqkglskslaaekqftddspdkeqlpcysv
    ariplpninedltcgnilmweavtvktevigvtamlnlhsgtqkthengagkpiqgsnfh
    ffavggeplelqgvlanyrtkypaqtvtpknatvdsqqmntdhkavldkdnaypvecwvp
    dpsknentryfgtytggenvppvlhitntattvlldeqgvgplckadslyvsavdicglf
    tntsgtqqwkglpryfkitlrkrsvkn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3bwrB (B:)
    gshmggievlgvktgvdsftevecflnpqmgnpdehqkglskslaaekqftddspdkeql
    pcysvariplpninedltcgnilmweavtvktevigvtamlnlhsgtqkthengagkpiq
    gsnfhffavggeplelqgvlanyrtkypaqtvtpknatvdsqqmntdhkavldkdnaypv
    ecwvpdpsknentryfgtytggenvppvlhitntattvlldeqgvgplckadslyvsavd
    icglftntsgtqqwkglpryfkitlrkrsvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bwrB (B:)
    sftevecflnpqmgnpdehqkglskslaaekqftddspdkeqlpcysvariplpninedl
    tcgnilmweavtvktevigvtamlnlhsgtqkthengagkpiqgsnfhffavggeplelq
    gvlanyrtkypaqtvtpknatvdsqqmntdhkavldkdnaypvecwvpdpsknentryfg
    tytggenvppvlhitntattvlldeqgvgplckadslyvsavdicglftntsgtqqwkgl
    pryfkitlrkrsvkn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3bwrC (C:)
    gshmggievlgvktgvdsftevecflnpqmgnpdehqkglskslaaekqftddspdkeql
    pcysvariplpninedltcgnilmweavtvktevigvtamlnlhsgtqkthengagkpiq
    gsnfhffavggeplelqgvlanyrtkypaqtvtpknatvdsqqmntdhkavldkdnaypv
    ecwvpdpsknentryfgtytggenvppvlhitntattvlldeqgvgplckadslyvsavd
    icglftntsgtqqwkglpryfkitlrkrsvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bwrC (C:)
    gievlgvktgvdsftevecflnpqmgnpdehqkglskslaaekqftddspdkeqlpcysv
    ariplpninedltcgnilmweavtvktevigvtamlnlhsgtqkthengagkpiqgsnfh
    ffavggeplelqgvlanyrtkypaqtvtpknatvdsqqmntdhkavldkdnaypvecwvp
    dpsknentryfgtytggenvppvlhitntattvlldeqgvgplckadslyvsavdicglf
    tntsgtqqwkglpryfkitlrkrsvkn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3bwrD (D:)
    gshmggievlgvktgvdsftevecflnpqmgnpdehqkglskslaaekqftddspdkeql
    pcysvariplpninedltcgnilmweavtvktevigvtamlnlhsgtqkthengagkpiq
    gsnfhffavggeplelqgvlanyrtkypaqtvtpknatvdsqqmntdhkavldkdnaypv
    ecwvpdpsknentryfgtytggenvppvlhitntattvlldeqgvgplckadslyvsavd
    icglftntsgtqqwkglpryfkitlrkrsvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bwrD (D:)
    gievlgvktgsftevecflnpqmgnpdehqkglskslaaekqftddspdkeqlpcysvar
    iplpninedltcgnilmweavtvktevigvtamlnlhsgtqkthengagkpiqgsnfhff
    avggeplelqgvlanyrtkypaqtvtpknatvdsqqmntdhkavldkdnaypvecwvpdp
    sknentryfgtytggenvppvlhitntattvlldeqgvgplckadslyvsavdicglftn
    tsgtqqwkglpryfkitlrkrsvkn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3bwrE (E:)
    gshmggievlgvktgvdsftevecflnpqmgnpdehqkglskslaaekqftddspdkeql
    pcysvariplpninedltcgnilmweavtvktevigvtamlnlhsgtqkthengagkpiq
    gsnfhffavggeplelqgvlanyrtkypaqtvtpknatvdsqqmntdhkavldkdnaypv
    ecwvpdpsknentryfgtytggenvppvlhitntattvlldeqgvgplckadslyvsavd
    icglftntsgtqqwkglpryfkitlrkrsvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bwrE (E:)
    ievlgvktdsftevecflnpqmgnpdehqkglskslaaekqftddspdkeqlpcysvari
    plpninedltcgnilmweavtvktevigvtamlnlhsgtqkthengagkpiqgsnfhffa
    vggeplelqgvlanyrtkypaqtvtpknatvdsqqmntdhkavldkdnaypvecwvpdps
    knentryfgtytggenvppvlhitntattvlldeqgvgplckadslyvsavdicglftnt
    sgtqqwkglpryfkitlrkrsvkn