PDB entry 3bwq

View 3bwq on RCSB PDB site
Description: Structure of free SV40 VP1 pentamer
Class: viral protein
Keywords: SV40, polyomavirus, ganglioside, GM1, viral receptor, virus attachment, Capsid protein, Late protein, Nucleus, Virion, VIRAL PROTEIN
Deposited on 2008-01-10, released 2008-03-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-10-05, with a file datestamp of 2011-09-30.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.212
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Capsid protein VP1
    Species: Simian virus 40 [TaxId:10633]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3bwqa_
  • Chain 'B':
    Compound: Capsid protein VP1
    Species: Simian virus 40 [TaxId:10633]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3bwqb_
  • Chain 'C':
    Compound: Capsid protein VP1
    Species: Simian virus 40 [TaxId:10633]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3bwqc_
  • Chain 'D':
    Compound: Capsid protein VP1
    Species: Simian virus 40 [TaxId:10633]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3bwqd_
  • Chain 'E':
    Compound: Capsid protein VP1
    Species: Simian virus 40 [TaxId:10633]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3bwqe_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bwqA (A:)
    gshmggievlgvktgvdsftevecflnpqmgnpdehqkglskslaaekqftddspdkeql
    pcysvariplpninedltcgnilmweavtvktevigvtamlnlhsgtqkthengagkpiq
    gsnfhffavggeplelqgvlanyrtkypaqtvtpknatvdsqqmntdhkavldkdnaypv
    ecwvpdpsknentryfgtytggenvppvlhitntattvlldeqgvgplckadslyvsavd
    icglftntsgtqqwkglpryfkitlrkrsvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bwqA (A:)
    gievlgvktgvdsftevecflnpqmgnpdehqkglskslaaekqftddspdkeqlpcysv
    ariplpninedltcgnilmweavtvktevigvtamlnlhsgtqkthengagkpiqgsnfh
    ffavggeplelqgvlanyrtkypaqtvtpknatvdsqqmntdhkavldkdnaypvecwvp
    dpsknentryfgtytggenvppvlhitntattvlldeqgvgplckadslyvsavdicglf
    tntsgtqqwkglpryfkitlrkrsvkn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3bwqB (B:)
    gshmggievlgvktgvdsftevecflnpqmgnpdehqkglskslaaekqftddspdkeql
    pcysvariplpninedltcgnilmweavtvktevigvtamlnlhsgtqkthengagkpiq
    gsnfhffavggeplelqgvlanyrtkypaqtvtpknatvdsqqmntdhkavldkdnaypv
    ecwvpdpsknentryfgtytggenvppvlhitntattvlldeqgvgplckadslyvsavd
    icglftntsgtqqwkglpryfkitlrkrsvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bwqB (B:)
    sftevecflnpqmgnpdehqkglskslaaekqftddspdkeqlpcysvariplpninedl
    tcgnilmweavtvktevigvtamlnlhsgtqkthengagkpiqgsnfhffavggeplelq
    gvlanyrtkypaqtvtpknatvdsqqmntdhkavldkdnaypvecwvpdpsknentryfg
    tytggenvppvlhitntattvlldeqgvgplckadslyvsavdicglftntsgtqqwkgl
    pryfkitlrkrsvkn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3bwqC (C:)
    gshmggievlgvktgvdsftevecflnpqmgnpdehqkglskslaaekqftddspdkeql
    pcysvariplpninedltcgnilmweavtvktevigvtamlnlhsgtqkthengagkpiq
    gsnfhffavggeplelqgvlanyrtkypaqtvtpknatvdsqqmntdhkavldkdnaypv
    ecwvpdpsknentryfgtytggenvppvlhitntattvlldeqgvgplckadslyvsavd
    icglftntsgtqqwkglpryfkitlrkrsvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bwqC (C:)
    gievlgvktgvdsftevecflnpqmgnpdehqkglskslaaekqftddspdkeqlpcysv
    ariplpninedltcgnilmweavtvktevigvtamlnlhsgtqkthengagkpiqgsnfh
    ffavggeplelqgvlanyrtkypaqtvtpknatvdsqqmntdhkavldkdnaypvecwvp
    dpsknentryfgtytggenvppvlhitntattvlldeqgvgplckadslyvsavdicglf
    tntsgtqqwkglpryfkitlrkrsvkn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3bwqD (D:)
    gshmggievlgvktgvdsftevecflnpqmgnpdehqkglskslaaekqftddspdkeql
    pcysvariplpninedltcgnilmweavtvktevigvtamlnlhsgtqkthengagkpiq
    gsnfhffavggeplelqgvlanyrtkypaqtvtpknatvdsqqmntdhkavldkdnaypv
    ecwvpdpsknentryfgtytggenvppvlhitntattvlldeqgvgplckadslyvsavd
    icglftntsgtqqwkglpryfkitlrkrsvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bwqD (D:)
    gievlgvktgsftevecflnpqmgnpdehqkglskslaaekqftddspdkeqlpcysvar
    iplpninedltcgnilmweavtvktevigvtamlnlhsgtqkthengagkpiqgsnfhff
    avggeplelqgvlanyrtkypaqtvtpknatvdsqqmntdhkavldkdnaypvecwvpdp
    sknentryfgtytggenvppvlhitntattvlldeqgvgplckadslyvsavdicglftn
    tsgtqqwkglpryfkitlrkrsvkn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3bwqE (E:)
    gshmggievlgvktgvdsftevecflnpqmgnpdehqkglskslaaekqftddspdkeql
    pcysvariplpninedltcgnilmweavtvktevigvtamlnlhsgtqkthengagkpiq
    gsnfhffavggeplelqgvlanyrtkypaqtvtpknatvdsqqmntdhkavldkdnaypv
    ecwvpdpsknentryfgtytggenvppvlhitntattvlldeqgvgplckadslyvsavd
    icglftntsgtqqwkglpryfkitlrkrsvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bwqE (E:)
    ievlgvktgdsftevecflnpqmgnpdehqkglskslaaekqftddspdkeqlpcysvar
    iplpninedltcgnilmweavtvktevigvtamlnlhsgtqkthengagkpiqgsnfhff
    avggeplelqgvlanyrtkypaqtvtpknatvdsqqmntdhkavldkdnaypvecwvpdp
    sknentryfgtytggenvppvlhitntattvlldeqgvgplckadslyvsavdicglftn
    tsgtqqwkglpryfkitlrkrsvkn