PDB entry 3bwm

View 3bwm on RCSB PDB site
Description: Crystal Structure of Human Catechol O-Methyltransferase with bound SAM and DNC
Class: transferase
Keywords: COMT, ROSSMANN FOLD, SAM, DNC, Alternative initiation, Catecholamine metabolism, Cytoplasm, Magnesium, Membrane, Methyltransferase, Neurotransmitter degradation, Polymorphism, S-adenosyl-L-methionine, Transferase, Transmembrane
Deposited on 2008-01-09, released 2008-06-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: 0.177
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catechol O-methyltransferase
    Species: HOMO SAPIENS
    Gene: COMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3bwma_
  • Heterogens: MG, K, SAM, DNC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bwmA (A:)
    gdtkeqrilnhvlqhaepgnaqsvleaidtyceqkewamnvgdkkgkivdaviqehqpsv
    llelgaycgysavrmarllspgarlitieinpdcaaitqrmvdfagvkdkvtlvvgasqd
    iipqlkkkydvdtldmvfldhwkdrylpdtllleecgllrkgtvlladnvicpgapdfla
    hvrgsscfecthyqsfleyrevvdglekaiykgp