PDB entry 3bw1

View 3bw1 on RCSB PDB site
Description: Crystal structure of homomeric yeast Lsm3 exhibiting novel octameric ring organisation
Class: RNA binding protein
Keywords: RNA-BINDING PROTEIN, SM-LIKE PROTEIN, SM PROTEIN, RING, HOMOMERIC, OCTAMER, mRNA processing, mRNA splicing, Nucleus, Ribonucleoprotein, rRNA processing, tRNA processing, RNA BINDING PROTEIN
Deposited on 2008-01-07, released 2008-03-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: U6 snRNA-associated Sm-like protein LSm3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SMX4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P57743 (7-95)
      • expression tag (5-6)
    Domains in SCOPe 2.08: d3bw1a1, d3bw1a2
  • Chain 'B':
    Compound: U6 snRNA-associated Sm-like protein LSm3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SMX4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P57743 (7-95)
      • expression tag (5-6)
    Domains in SCOPe 2.08: d3bw1b1, d3bw1b2
  • Heterogens: MPD, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bw1A (A:)
    mhhhhhhmetpldllklnldervyiklrgartlvgtlqafdshcnivlsdavetiyqlnn
    eelseserrcemvfirgdtvtlistpsedddgavei
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bw1A (A:)
    hhmetpldllklnldervyiklrgartlvgtlqafdshcnivlsdavetiyqlnneelse
    serrcemvfirgdtvtlistpsavei
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3bw1B (B:)
    mhhhhhhmetpldllklnldervyiklrgartlvgtlqafdshcnivlsdavetiyqlnn
    eelseserrcemvfirgdtvtlistpsedddgavei
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bw1B (B:)
    hhmetpldllklnldervyiklrgartlvgtlqafdshcnivlsdavetiyqlnneelse
    serrcemvfirgdtvtlistpsavei