PDB entry 3bvs

View 3bvs on RCSB PDB site
Description: Crystal Structure of Bacillus cereus Alkylpurine DNA Glycosylase AlkD
Class: hydrolase
Keywords: DNA glycosylase, HEAT repeat, alkylpurine, DNA repair, HYDROLASE
Deposited on 2008-01-07, released 2008-07-15
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.19
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alkylpurine DNA Glycosylase AlkD
    Species: Bacillus cereus
    Gene: AlkD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q816E8 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.02: d3bvsa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bvsA (A:)
    vpmhpfvkalqehftahqnpekaepmarymknhflflgiqtperrqllkdiiqihtlpdq
    kdfqiiirelwdlperefqaaaldimqkykkhinethipfleelivtkswwdsvdsivpt
    flgdiflkhpelisayipkwiasdniwlqraailfqlkykqkmdeellfwiigqlhsske
    ffiqkaigwvlreyaktnpdvvweyvqnnelaplskreaikhikqnyginnekigetls
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bvsA (A:)
    vpmhpfvkalqehftahqnpekaepmarymknhflflgiqtperrqllkdiiqihtlpdq
    kdfqiiirelwdlperefqaaaldimqkykkhinethipfleelivtkswwdsvdsivpt
    flgdiflkhpelisayipkwiasdniwlqraailfqlkykqkmdeellfwiigqlhsske
    ffiqkaigwvlreyaktnpdvvweyvqnnelaplskreaikhikqny