PDB entry 3bvi

View 3bvi on RCSB PDB site
Description: Structural basis for the iron uptake mechanism of Helicobacter pylori ferritin
Class: Oxidoreductase
Keywords: iron storage, Metal-binding, Oxidoreductase
Deposited on 2008-01-07, released 2009-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.185
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferritin
    Species: Helicobacter pylori [TaxId:210]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZLI1 (14-End)
      • expression tag (8-13)
    Domains in SCOPe 2.07: d3bvia1, d3bvia2
  • Chain 'B':
    Compound: Ferritin
    Species: Helicobacter pylori [TaxId:210]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZLI1 (14-End)
      • expression tag (8-13)
    Domains in SCOPe 2.07: d3bvib1, d3bvib2
  • Chain 'C':
    Compound: Ferritin
    Species: Helicobacter pylori [TaxId:210]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZLI1 (14-End)
      • expression tag (8-13)
    Domains in SCOPe 2.07: d3bvic1, d3bvic2
  • Chain 'D':
    Compound: Ferritin
    Species: Helicobacter pylori [TaxId:210]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZLI1 (14-End)
      • expression tag (8-13)
    Domains in SCOPe 2.07: d3bvid1, d3bvid2
  • Chain 'E':
    Compound: Ferritin
    Species: Helicobacter pylori [TaxId:210]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZLI1 (14-End)
      • expression tag (8-13)
    Domains in SCOPe 2.07: d3bvie1, d3bvie2
  • Chain 'F':
    Compound: Ferritin
    Species: Helicobacter pylori [TaxId:210]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZLI1 (14-180)
      • expression tag (8-13)
    Domains in SCOPe 2.07: d3bvif1, d3bvif2
  • Heterogens: FE, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bviA (A:)
    mgsshhhhhhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdh
    aaeeyehakkliiflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivd
    haikskdhatfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bviA (A:)
    hhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeha
    kkliiflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdh
    atfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3bviB (B:)
    mgsshhhhhhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdh
    aaeeyehakkliiflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivd
    haikskdhatfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bviB (B:)
    hhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeha
    kkliiflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdh
    atfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3bviC (C:)
    mgsshhhhhhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdh
    aaeeyehakkliiflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivd
    haikskdhatfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bviC (C:)
    hhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeha
    kkliiflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdh
    atfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3bviD (D:)
    mgsshhhhhhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdh
    aaeeyehakkliiflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivd
    haikskdhatfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bviD (D:)
    hhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeha
    kkliiflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdh
    atfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3bviE (E:)
    mgsshhhhhhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdh
    aaeeyehakkliiflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivd
    haikskdhatfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bviE (E:)
    hhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeha
    kkliiflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdh
    atfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3bviF (F:)
    mgsshhhhhhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdh
    aaeeyehakkliiflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivd
    haikskdhatfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bviF (F:)
    hhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeha
    kkliiflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdh
    atfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrks