PDB entry 3bvb
View 3bvb on RCSB PDB site
Description: Cystal structure of HIV-1 Active Site Mutant D25N and inhibitor Darunavir
Class: hydrolase
Keywords: DRUG RESISTANCE; HIV-1; D25N, MUTANT, AIDS, Aspartyl protease, Capsid maturation, Core protein, DNA integration, DNA recombination, DNA-directed DNA polymerase, Endonuclease, Hydrolase, Lipoprotein, Magnesium, Membrane, Metal-binding, Multifunctional enzyme, Myristate, Nuclease, Nucleotidyltransferase, Nucleus, Phosphoprotein, Protease, RNA-binding, RNA-directed DNA polymerase, Transferase, Viral nucleoprotein, Virion, Zinc-finger
Deposited on
2008-01-05, released
2008-04-01
The last revision prior to the SCOPe 2.01 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-25.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.16
AEROSPACI score: 0.76
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Protease (Retropepsin)
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P03367 (0-98)
- engineered (6)
- engineered (24)
- engineered (32)
- engineered (62)
- engineered (66)
- engineered (94)
Domains in SCOPe 2.01: d3bvba_ - Chain 'B':
Compound: Protease (Retropepsin)
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P03367 (0-98)
- engineered (6)
- engineered (24)
- engineered (32)
- engineered (62)
- engineered (66)
- engineered (94)
Domains in SCOPe 2.01: d3bvbb_ - Heterogens: NA, CL, 017, GOL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3bvbA (A:)
pqitlwkrplvtikiggqlkeallntgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3bvbB (B:)
pqitlwkrplvtikiggqlkeallntgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf