PDB entry 3bv0

View 3bv0 on RCSB PDB site
Description: Crystal Structure of PLP Bound 7,8-Diaminopelargonic Acid Synthase in Mycobacterium Tuberculosis
Class: transferase
Keywords: aminotransferase, biotin biosynthesis, Pyridoxal phosphate, S-adenosyl-L-methionine, TRANSFERASE
Deposited on 2008-01-04, released 2008-02-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-01-25, with a file datestamp of 2012-01-20.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: 0.19
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenosylmethionine-8-amino-7-oxononanoate aminotransferase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bioA, Rv1568
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3bv0a_
  • Chain 'B':
    Compound: Adenosylmethionine-8-amino-7-oxononanoate aminotransferase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bioA, Rv1568
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3bv0b_
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bv0A (A:)
    maaatggltpeqiiavdgahlwhpyssigreavspvvavaahgawltlirdgqpievlda
    msswwtaihghghpaldqalttqlrvmnhvmfgglthepaarlakllvditpagldtvff
    sdsgsvsvevaakmalqywrgrglpgkrrlmtwrggyhgdtflamsicdphggmhslwtd
    vlaaqvfapqvprdydpaysaafeaqlaqhagelaavvvepvvqgaggmrfhdprylhdl
    rdicrryevllifdeiatgfgrtgalfaadhagvspdimcvgkaltggylslaatlctad
    vahtisagaagalmrgptfmanplacavsvasvelllgqdwrtritelaagltagldtar
    alpavtdvrvcgaigviecdrpvdlavatpaaldrgvwlrpfrnlvyamppyictpaeit
    qitsamvevarlvgslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bv0A (A:)
    gltpeqiiavdgahlwhpspvvavaahgawltlirdgqpievldamsswwtaihghghpa
    ldqalttqlrvmnhvmfgglthepaarlakllvditpagldtvffsdsgsvsvevaakma
    lqywrgrglpgkrrlmtwrggyhgdtflamsicdphggmhslwtdvlaaqvfapqvprdy
    dpaysaafeaqlaqhagelaavvvepvvqgaggmrfhdprylhdlrdicrryevllifde
    iatgfgrtgalfaadhagvspdimcvgkaltggylslaatlctadvahtisagptfmanp
    lacavsvasvelllgqdwrtritelaagltagldtaralpavtdvrvcgaigviecdrpv
    dlavatpaaldrgvwlrpfrnlvyamppyictpaeitqitsamvevarlv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3bv0B (B:)
    maaatggltpeqiiavdgahlwhpyssigreavspvvavaahgawltlirdgqpievlda
    msswwtaihghghpaldqalttqlrvmnhvmfgglthepaarlakllvditpagldtvff
    sdsgsvsvevaakmalqywrgrglpgkrrlmtwrggyhgdtflamsicdphggmhslwtd
    vlaaqvfapqvprdydpaysaafeaqlaqhagelaavvvepvvqgaggmrfhdprylhdl
    rdicrryevllifdeiatgfgrtgalfaadhagvspdimcvgkaltggylslaatlctad
    vahtisagaagalmrgptfmanplacavsvasvelllgqdwrtritelaagltagldtar
    alpavtdvrvcgaigviecdrpvdlavatpaaldrgvwlrpfrnlvyamppyictpaeit
    qitsamvevarlvgslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bv0B (B:)
    ggltpeqiiavdgahlwhpspvvavaahgawltlirdgqpievldamsswwtaihghghp
    aldqalttqlrvmnhvmfgglthepaarlakllvditpagldtvffsdsgsvsvevaakm
    alqywrgrglpgkrrlmtwrggyhgdtflamsicdphggmhslwtdvlaaqvfapqvprd
    ydpaysaafeaqlaqhagelaavvvepvvqgaggmrfhdprylhdlrdicrryevllifd
    eiatgfgrtgalfaadhagvspdimcvgkaltggylslaatlctadvahtisagptfman
    placavsvasvelllgqdwrtritelaagltagldtaralpavtdvrvcgaigviecdrp
    vdlavatpaaldrgvwlrpfrnlvyamppyictpaeitqitsamvevarlvgsl