PDB entry 3buy

View 3buy on RCSB PDB site
Description: MHC-I in complex with peptide
Class: immune system
Keywords: MHC-I, Glycoprotein, Immune response, Membrane, MHC I, Transmembrane, Immunoglobulin domain, Polymorphism, Secreted, Apoptosis, Cytoplasm, Host-virus interaction, Inner membrane, Mitochondrion, Nucleus, IMMUNE SYSTEM
Deposited on 2008-01-03, released 2008-03-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.248
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: H-2 class I histocompatibility antigen, D-B alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: H2-D1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3buya1, d3buya2
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Mus musculus [TaxId:10090]
    Gene: B2M
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3buyb_
  • Chain 'C':
    Compound: epitope of PB1-F2
    Species: Influenza A virus [TaxId:11320]
    Gene: Pb1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3buyA (A:)
    phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe
    retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr
    dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr
    tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
    qkwasvvvplgkeqnytcrvyheglpepltlrwep
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3buyB (B:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'C':
    No sequence available.