PDB entry 3but

View 3but on RCSB PDB site
Description: crystal structure of protein af_0446 from archaeoglobus fulgidus
Deposited on 2008-01-03, released 2008-01-15
The last revision was dated 2021-10-20, with a file datestamp of 2021-10-15.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein Af_0446
    Species: Archaeoglobus fulgidus [TaxId:224325]
    Gene: AF_0446
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29803 (3-127)
      • expression tag (0-2)
      • engineered mutation (63)
      • engineered mutation (65)
      • engineered mutation (79)
      • engineered mutation (105)
      • expression tag (128-135)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3butA (A:)
mslesvkamwgvvtdsqteivalakvrnedvvpivvsgyhytiemngvkvadgyenspvt
vkpasattlkfslrlnnsflrewwvthiangektkirvaikptieiggrdvevpvflres
efttkllseghhhhhh

    Sequence, based on observed residues (ATOM records):
    >3butA (A:)
slesvkamwgvvtdsqteivalakvrnedvvpivvsgyhytiemngvkvadgyenspvtv
kpasattlkfslrlnnsflrewwvthiangektkirvaikptieigrdvevpvflresef
ttkll