PDB entry 3buj

View 3buj on RCSB PDB site
Description: Crystal Structure of CalO2
Class: metal binding protein
Keywords: P450, Heme, Iron, Metal-binding, Monooxygenase, Oxidoreductase, METAL BINDING PROTEIN
Deposited on 2008-01-02, released 2008-04-29
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-01-30, with a file datestamp of 2013-01-25.
Experiment type: XRAY
Resolution: 2.47 Å
R-factor: 0.201
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CalO2
    Species: Micromonospora echinospora [TaxId:1877]
    Gene: calO2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KND6 (1-396)
      • expression tag (0)
    Domains in SCOPe 2.03: d3buja_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bujA (A:)
    vtafdptdadvrrdpypsyhwllrhdpvhrgahrvwyvsrfadvravlgderfartgirr
    fwtdlvgpgllaeivgdiilfqdepdhgrlrgvvgpafspsalrrlepviagtvddllrp
    alargamdvvdelayplalravlgllglpaadwgavgrwsrdvgrtldrgasaedmrrgh
    aaiaefadyveralarrrreggedllalmldahdrglmsrneivstvvtfiftghetvas
    qvgnavlsllahpdqldllrrrpdllaqaveeclrydpsvqsntrqldvdvelrgrrlrr
    ddvvvvlagaanrdprrydrpddfdierdpvpsmsfgagmryclgsylartqlraavaal
    arlpglrlgcasdalayqprtmfrglaslpiaftpgg