PDB entry 3bua

View 3bua on RCSB PDB site
Description: Crystal Structure of TRF2 TRFH domain and APOLLO peptide complex
Class: DNA binding protein
Keywords: TRF2 TRFH domain Dimerization domain APOLLO peptide, Alternative splicing, Cell cycle, Chromosomal protein, DNA-binding, Nucleus, Phosphoprotein, Telomere, DNA damage, DNA repair, Polymorphism, DNA BINDING PROTEIN
Deposited on 2008-01-02, released 2008-02-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.229
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Telomeric repeat-binding factor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: TERF2, TRBF2, TRF2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3buaa_
  • Chain 'B':
    Compound: Telomeric repeat-binding factor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: TERF2, TRBF2, TRF2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3buab_
  • Chain 'C':
    Compound: Telomeric repeat-binding factor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: TERF2, TRBF2, TRF2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3buac_
  • Chain 'D':
    Compound: Telomeric repeat-binding factor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: TERF2, TRBF2, TRF2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3buad_
  • Chain 'E':
    Compound: DNA cross-link repair 1B protein
    Species: Homo sapiens [TaxId:9606]
    Gene: DCLRE1B, SNM1B
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: DNA cross-link repair 1B protein
    Species: Homo sapiens [TaxId:9606]
    Gene: DCLRE1B, SNM1B
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: DNA cross-link repair 1B protein
    Species: Homo sapiens [TaxId:9606]
    Gene: DCLRE1B, SNM1B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H816 (0-End)
      • see remark 999 (0)
  • Chain 'H':
    Compound: DNA cross-link repair 1B protein
    Species: Homo sapiens [TaxId:9606]
    Gene: DCLRE1B, SNM1B
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3buaA (A:)
    gagearleeavnrwvlkfyfhealrafrgsrygdfrqirdimqallvrplgkehtvsrll
    rvmqclsrieegenldcsfdmeaeltplesainvlemikteftlteavvessrklvkeaa
    viiciknkefekaskilkkhmskdpttqklrndllniireknlahpviqnfsyetfqqkm
    lrfleshlddaepylltmakkalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3buaA (A:)
    gearleeavnrwvlkfyfhealrafrgsrygdfrqirdimqallvrplgkehtvsrllrv
    mqclsrieegenldcsfdmeaeltplesainvlemikteftlteavvessrklvkeaavi
    iciknkefekaskilkkhmskdpttqklrndllniireknlahpviqnfsyetfqqkmlr
    fleshlddaepylltmakkalk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3buaB (B:)
    gagearleeavnrwvlkfyfhealrafrgsrygdfrqirdimqallvrplgkehtvsrll
    rvmqclsrieegenldcsfdmeaeltplesainvlemikteftlteavvessrklvkeaa
    viiciknkefekaskilkkhmskdpttqklrndllniireknlahpviqnfsyetfqqkm
    lrfleshlddaepylltmakkalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3buaB (B:)
    gearleeavnrwvlkfyfhealrafrgsrygdfrqirdimqallvrplgkehtvsrllrv
    mqclsrieegenldcsfdmeaeltplesainvlemikteftlteavvessrklvkeaavi
    iciknkefekaskilkkhmskdpttqklrndllniireknlahpviqnfsyetfqqkmlr
    fleshlddaepylltmakkalk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3buaC (C:)
    gagearleeavnrwvlkfyfhealrafrgsrygdfrqirdimqallvrplgkehtvsrll
    rvmqclsrieegenldcsfdmeaeltplesainvlemikteftlteavvessrklvkeaa
    viiciknkefekaskilkkhmskdpttqklrndllniireknlahpviqnfsyetfqqkm
    lrfleshlddaepylltmakkalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3buaC (C:)
    gearleeavnrwvlkfyfhealrafrgsrygdfrqirdimqallvrplgkehtvsrllrv
    mqclsrieegenldcsfdmeaeltplesainvlemikteftlteavvessrklvkeaavi
    iciknkefekaskilkkhmskdpttqklrndllniireknlahpviqnfsyetfqqkmlr
    fleshlddaepylltmakkalk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3buaD (D:)
    gagearleeavnrwvlkfyfhealrafrgsrygdfrqirdimqallvrplgkehtvsrll
    rvmqclsrieegenldcsfdmeaeltplesainvlemikteftlteavvessrklvkeaa
    viiciknkefekaskilkkhmskdpttqklrndllniireknlahpviqnfsyetfqqkm
    lrfleshlddaepylltmakkalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3buaD (D:)
    gearleeavnrwvlkfyfhealrafrgsrygdfrqirdimqallvrplgkehtvsrllrv
    mqclsrieegenldcsfdmeaeltplesainvlemikteftlteavvessrklvkeaavi
    iciknkefekaskilkkhmskdpttqklrndllniireknlahpviqnfsyetfqqkmlr
    fleshlddaepylltmakkalk
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.