PDB entry 3bu8

View 3bu8 on RCSB PDB site
Description: Crystal Structure of TRF2 TRFH domain and TIN2 peptide complex
Class: DNA binding protein
Keywords: TRF2 TRFH domain TRF2 dimerization domain TIN2 peptide, Alternative splicing, Cell cycle, Chromosomal protein, DNA-binding, Nucleus, Phosphoprotein, Telomere, DNA BINDING PROTEIN
Deposited on 2008-01-02, released 2008-02-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.238
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Telomeric repeat-binding factor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: TERF2, TRBF2, TRF2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3bu8a_
  • Chain 'B':
    Compound: Telomeric repeat-binding factor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: TERF2, TRBF2, TRF2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3bu8b_
  • Chain 'C':
    Compound: TERF1-interacting nuclear factor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: TINF2, TIN2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BSI4 (1-End)
      • see remark 999 (0)
  • Chain 'D':
    Compound: TERF1-interacting nuclear factor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: TINF2, TIN2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BSI4 (1-End)
      • see remark 999 (0)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bu8A (A:)
    gagearleeavnrwvlkfyfhealrafrgsrygdfrqirdimqallvrplgkehtvsrll
    rvmqclsrieegenldcsfdmeaeltplesainvlemikteftlteavvessrklvkeaa
    viiciknkefekaskilkkhmskdpttqklrndllniireknlahpviqnfsyetfqqkm
    lrfleshlddaepylltmakkalksesaasstgkedkqpapgpvekppreparql
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bu8A (A:)
    gearleeavnrwvlkfyfhealrafrgsrygdfrqirdimqallvrplgkehtvsrllrv
    mqclsrieegenldcsfdmeaeltplesainvlemikteftlteavvessrklvkeaavi
    iciknkefekaskilkkhmskdpttqklrndllniireknlahpviqnfsyetfqqkmlr
    fleshlddaepylltmakkalkse
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3bu8B (B:)
    gagearleeavnrwvlkfyfhealrafrgsrygdfrqirdimqallvrplgkehtvsrll
    rvmqclsrieegenldcsfdmeaeltplesainvlemikteftlteavvessrklvkeaa
    viiciknkefekaskilkkhmskdpttqklrndllniireknlahpviqnfsyetfqqkm
    lrfleshlddaepylltmakkalksesaasstgkedkqpapgpvekppreparql
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bu8B (B:)
    agearleeavnrwvlkfyfhealrafrgsrygdfrqirdimqallvrplgkehtvsrllr
    vmqclsrieegenldcsfdmeaeltplesainvlemikteftlteavvessrklvkeaav
    iiciknkefekaskilkkhmskdpttqklrndllniireknlahpviqnfsyetfqqkml
    rfleshlddaepylltmakkalksesa
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.