PDB entry 3bu4

View 3bu4 on RCSB PDB site
Description: ribonuclease t1 complex with 2'gmp
Class: hydrolase
Keywords: endoribonuclease, hydrolase
Deposited on 1998-09-14, released 1998-09-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: 0.199
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ribonuclease t1)
    Species: Aspergillus oryzae [TaxId:5062]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00651 (0-103)
      • conflict (24)
    Domains in SCOPe 2.08: d3bu4a_
  • Heterogens: CA, 2GP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bu4A (A:)
    acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
    ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect