PDB entry 3btz

View 3btz on RCSB PDB site
Description: crystal structure of human abh2 cross-linked to dsdna
Deposited on 2007-12-31, released 2008-04-22
The last revision was dated 2021-10-20, with a file datestamp of 2021-10-15.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.237
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Alpha-ketoglutarate-dependent dioxygenase alkB homolog 2
  Species: Homo sapiens [TaxId:9606]
  Gene: ALKBH2, ABH2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6NS38 (0-201)
    • engineered mutation (10)
    • engineered mutation (108)
    • engineered mutation (118)
    • engineered mutation (135)
• Chain 'B':
  Compound: DNA (5'-d(*ap*gp*gp*tp*gp*ap*(2yr)p*ap*ap*tp*gp*cp*g)-3')
  
• Chain 'C':
  Compound: DNA (5'-d(*dtp*dcp*dgp*dcp*dap*dtp*dtp*dap*dtp*dcp*dap*dcp*dc)-3')
  
• Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records:
  

  >3btzA (A:)
  wrhiraegldssytvlfgkaeadeifqelekeveyftgalarvqvfgkwhsvprkqatyg
  dagltytfsgltlspkpwipvlerirdhvsgvtgqtfnfvlinrykdgsdhigehrddcr
  elapgspiasvsfgasrdfvfrhkdsrgkspsrrvavvrlplahgsllmmnhptnthwyh
  slpvrkkvlaprvnltfrkill
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.