PDB entry 3btr

View 3btr on RCSB PDB site
Description: AR-NLS:Importin-alpha complex
Class: hormone
Keywords: importin-alpha/androgen receptor complex, Cytoplasm, Nucleus, Phosphoprotein, Protein transport, Transport, Disease mutation, DNA-binding, Lipid-binding, Metal-binding, Polymorphism, Steroid-binding, Transcription, Transcription regulation, Triplet repeat expansion, Ubl conjugation, Zinc, Zinc-finger, HORMONE
Deposited on 2007-12-30, released 2008-12-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2008-12-30, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.189
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Androgen receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Importin subunit alpha-2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3btrc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3btrC (C:)
    nqgtvnwsvedivkginsnnlesqlqatqaarkllsrekqppidniiraglipkfvsflg
    ktdcspiqfesawaltniasgtseqtkavvdggaipafisllasphahiseqavwalgni
    agdgsafrdlvikhgaidpllallavpdlstlacgylrnltwtlsnlcrnknpappldav
    eqilptlvrllhhndpevladscwaisyltdgpneriemvvkkgvvpqlvkllgatelpi
    vtpalraignivtgtdeqtqkvidagalavfpslltnpktniqkeatwtmsnitagrqdq
    iqqvvnhglvpflvgvlskadfktqkeaawaitnytsggtveqivylvhcgiieplmnll
    sakdtkiiqvildaisnifqaaeklgeteklsimieecggldkiealqrhenesvykasl
    nliekyf