PDB entry 3btl

View 3btl on RCSB PDB site
Description: crystal structure of QacR(E58Q) bound to malachite green
Class: transcription
Keywords: QacR, multidrug binding, Malachite green, dye, DNA-binding, Plasmid, Repressor, Transcription, Transcription regulation
Deposited on 2007-12-28, released 2008-08-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.211
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HTH-type transcriptional regulator qacR
    Species: Staphylococcus aureus
    Gene: qacR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0N3
      • engineered (57)
      • engineered (71)
      • engineered (140)
    Domains in SCOPe 2.07: d3btla1, d3btla2
  • Chain 'B':
    Compound: HTH-type transcriptional regulator qacR
    Species: Staphylococcus aureus
    Gene: qacR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0N3
      • engineered (57)
      • engineered (71)
      • engineered (140)
    Domains in SCOPe 2.07: d3btlb1, d3btlb2
  • Chain 'D':
    Compound: HTH-type transcriptional regulator qacR
    Species: Staphylococcus aureus
    Gene: qacR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0N3
      • engineered (57)
      • engineered (71)
      • engineered (140)
    Domains in SCOPe 2.07: d3btld1, d3btld2
  • Chain 'E':
    Compound: HTH-type transcriptional regulator qacR
    Species: Staphylococcus aureus
    Gene: qacR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0N3
      • engineered (57)
      • engineered (71)
      • engineered (140)
    Domains in SCOPe 2.07: d3btle1, d3btle2
  • Heterogens: SO4, MGR

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3btlA (A:)
    mnlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieqsk
    wqeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnkle
    nkyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsq
    iflnglsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3btlA (A:)
    nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieqskw
    qeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklen
    kyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqi
    flngls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3btlB (B:)
    mnlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieqsk
    wqeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnkle
    nkyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsq
    iflnglsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3btlB (B:)
    nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieqskw
    qeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklen
    kyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqi
    flngls
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3btlD (D:)
    mnlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieqsk
    wqeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnkle
    nkyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsq
    iflnglsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3btlD (D:)
    nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieqskw
    qeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklen
    kyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqi
    flngls
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3btlE (E:)
    mnlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieqsk
    wqeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnkle
    nkyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsq
    iflnglsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3btlE (E:)
    nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieqskw
    qeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklen
    kyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqi
    flngls