PDB entry 3bti

View 3bti on RCSB PDB site
Description: crystal structure of QacR(E58Q) bound to berberine
Class: transcription
Keywords: QacR, multidrug binding, Berberine, natural drug, DNA-binding, Plasmid, Repressor, Transcription, Transcription regulation
Deposited on 2007-12-28, released 2008-08-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.217
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HTH-type transcriptional regulator qacR
    Species: Staphylococcus aureus
    Gene: qacR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0N3
      • engineered (57)
      • engineered (71)
      • engineered (140)
    Domains in SCOPe 2.06: d3btia1, d3btia2
  • Chain 'B':
    Compound: HTH-type transcriptional regulator qacR
    Species: Staphylococcus aureus
    Gene: qacR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0N3
      • engineered (57)
      • engineered (71)
      • engineered (140)
    Domains in SCOPe 2.06: d3btib1, d3btib2
  • Chain 'D':
    Compound: HTH-type transcriptional regulator qacR
    Species: Staphylococcus aureus
    Gene: qacR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0N3
      • engineered (57)
      • engineered (71)
      • engineered (140)
    Domains in SCOPe 2.06: d3btid1, d3btid2
  • Chain 'E':
    Compound: HTH-type transcriptional regulator qacR
    Species: Staphylococcus aureus
    Gene: qacR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0N3
      • engineered (57)
      • engineered (71)
      • engineered (140)
    Domains in SCOPe 2.06: d3btie1, d3btie2
  • Heterogens: SO4, BER, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3btiA (A:)
    mnlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieqsk
    wqeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnkle
    nkyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsq
    iflnglsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3btiA (A:)
    nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieqskw
    qeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklen
    kyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqi
    flngls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3btiB (B:)
    mnlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieqsk
    wqeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnkle
    nkyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsq
    iflnglsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3btiB (B:)
    nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieqskw
    qeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklen
    kyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqi
    flngls
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3btiD (D:)
    mnlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieqsk
    wqeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnkle
    nkyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsq
    iflnglsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3btiD (D:)
    nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieqskw
    qeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklen
    kyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqi
    flngls
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3btiE (E:)
    mnlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieqsk
    wqeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnkle
    nkyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsq
    iflnglsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3btiE (E:)
    nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieqskw
    qeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklen
    kyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqi
    flngls