PDB entry 3btg

View 3btg on RCSB PDB site
Description: the crystal structures of the complexes between bovine beta-trypsin and ten p1 variants of bpti
Class: hydrolase/hydrolase inhibitor
Keywords: trypsin, bpti, serine proteinase, inhibitor, hydrolase-hydrolase inhibitor complex
Deposited on 1999-03-10, released 2000-03-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: protein (trypsin)
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3btge_
  • Chain 'I':
    Compound: protein (pancreatic trypsin inhibitor)
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00974 (Start-57)
      • engineered mutation (14)
      • engineered mutation (51)
    Domains in SCOPe 2.08: d3btgi_
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3btgE (E:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3btgI (I:)
    rpdfcleppytgpcgariiryfynakaglcqtfvyggcrakrnnfksaedclrtcgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3btgI (I:)
    dfcleppytgpcgariiryfynakaglcqtfvyggcrakrnnfksaedclrtcgga