PDB entry 3bte

View 3bte on RCSB PDB site
Description: The Crystal Structures of the Complexes Between Bovine Beta-Trypsin and Ten P1 Variants of BPTI.
Class: hydrolase
Keywords: trypsin, bpti, serine proteinase, inhibitor, hydrolase
Deposited on 1999-03-11, released 2000-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: Trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3btee_
  • Chain 'I':
    Compound: pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00974 (Start-57)
      • engineered (14)
      • engineered (51)
    Domains in SCOPe 2.07: d3btei_
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bteE (E:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3bteI (I:)
    rpdfcleppytgpceariiryfynakaglcqtfvyggcrakrnnfksaedclrtcgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bteI (I:)
    dfcleppytgpceariiryfynakaglcqtfvyggcrakrnnfksaedclrtcgga