PDB entry 3btd

View 3btd on RCSB PDB site
Description: The Crystal Structures of the Complexes Between the Bovine Beta-Trypsin and Ten P1 Variants of BPTI.
Class: hydrolase/hydrolase inhibitor
Keywords: trypsin, bpti, serine proteinase, inhibitor, hydrolase-hydrolase inhibitor complex
Deposited on 1999-03-11, released 2000-03-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.195
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: protein (trypsin)
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3btde_
  • Chain 'I':
    Compound: protein (bovine pancreatic trypsin inhibitor)
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00974 (Start-57)
      • mutation (14)
      • mutation (51)
    Domains in SCOPe 2.04: d3btdi_
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3btdE (E:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

  • Chain 'I':
    Sequence, based on SEQRES records: (download) 
    >3btdI (I:)
rpdfcleppytgpcdariiryfynakaglcqtfvyggcrakrnnfksaedclrtcgga

    Sequence, based on observed residues (ATOM records): (download) 
    >3btdI (I:)
dfcleppytgpcdariiryfynakaglcqtfvyggcrakrnnfksaedclrtcgga