PDB entry 3bt6

View 3bt6 on RCSB PDB site
Description: Crystal Structure of Influenza B Virus Hemagglutinin
Class: viral protein
Keywords: Antigenic variation, membrane fusion, Envelope protein, Fusion protein, Hemagglutinin, Transmembrane, Virion, Glycoprotein, Lipoprotein, Palmitate, VIRAL PROTEIN
Deposited on 2007-12-27, released 2008-05-27
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.283
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Influenza B hemagglutinin (HA)
    Species: Influenza B virus
    Gene: Hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3bt6a_
  • Chain 'B':
    Compound: Influenza B hemagglutinin (HA)
    Species: Influenza B virus
    Gene: Hemagglutinin
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NDG, NAG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bt6A (A:)
    drictgitssnsphvvktatqgevnvtgvipltttptkshfanlkgtqtrgklcpnclnc
    tdldvalgrpkcmgtipsakasilhevkpvtsgcfpimhdrtkirqlpnllrgyenirls
    arnvtnaetapggpyivgtsgscpnvtngngffatmawavpknktatnpltvevpyictk
    gedqitvwgfhsddetqmvklygdskpqkftssangvtthyvsqiggfpnqaedeglpqs
    grivvdymvqkpgktgtiayqrgvllpqkvwcasgrskvikgslpligeadclhekyggl
    nkskpyytgehakaigncpiwvktplklangtkyrppakllk
    

  • Chain 'B':
    No sequence available.