PDB entry 3bt2

View 3bt2 on RCSB PDB site
Description: Structure of urokinase receptor, urokinase and vitronectin complex
Class: immune system
Keywords: protein-protein interaction, Glycoprotein, GPI-anchor, Lipoprotein, Membrane, Receptor, Secreted, Blood coagulation, EGF-like domain, Fibrinolysis, Hydrolase, Kringle, Phosphoprotein, Plasminogen activation, Protease, Serine protease, Zymogen, Cell adhesion, Heparin-binding, Sulfation, Immunoglobulin domain, IMMUNE SYSTEM
Deposited on 2007-12-27, released 2008-03-25
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.23
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: urokinase-type plasminogen activator
    Species: Homo sapiens [TaxId:9606]
    Gene: PLAU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3bt2a1, d3bt2a2
  • Chain 'B':
    Compound: Vitronectin
    Species: Homo sapiens [TaxId:9606]
    Gene: VTN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3bt2b_
  • Chain 'H':
    Compound: anti-uPAR antibody, heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3BT2 (0-End)
    Domains in SCOPe 2.02: d3bt2h1, d3bt2h2
  • Chain 'L':
    Compound: anti-uPAR antibody, light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3BT2 (0-End)
    Domains in SCOPe 2.02: d3bt2l1, d3bt2l2
  • Chain 'U':
    Compound: Urokinase plasminogen activator surface receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: PLAUR, MO3, UPAR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03405 (2-End)
      • expression tag (2)
    Domains in SCOPe 2.02: d3bt2u1, d3bt2u2, d3bt2u3
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bt2A (A:)
    rssnelhqvpsncdclnggtcvsnkyfsnihwcncpkkfggqhceidksktcyegnghfy
    rgkastdtmgrpclpwnsatvlqqtyhahrsdalqlglgkhnycrnpdnrrrpwcyvqvg
    lkplvqecmvhdcad
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bt2A (A:)
    sncdclnggtcvsnkyfsnihwcncpkkfggqhceidksktcyegnghfyrgkastdtmg
    rpclpwnsatvlqqtyhahrsdalqlglgkhnycrnpdnrrrpwcyvqvglkplvqecmv
    hdca
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bt2B (B:)
    qesckgrctegfnvdkkcqcdelcsyyqscctdytaeckp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3bt2H (H:)
    gvklqqsgpevvkpgasvkisckasgysftnfyihwvkqrpgqglewigwifhgsdntey
    nekfkdkatltadtssstaymqlssltsedsavyfcarwgphwyfdvwgqgttvtvssak
    ttppsvyplapgnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsss
    vtvpsstwpsetvtcnvahpasstkvdkkiaaag
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bt2H (H:)
    gvklqqsgpevvkpgasvkisckasgysftnfyihwvkqrpgqglewigwifhgsdntey
    nekfkdkatltadtssstaymqlssltsedsavyfcarwgphwyfdvwgqgttvtvssak
    ttppsvyplapnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssv
    tvpsstwpsetvtcnvahpasstkvdkkiaaa
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3bt2L (L:)
    divltqspditaaslgqkvtitcsasssvsymhwyqqksgtspkpwifeisklasgvpar
    fsgsgsgtsysltissmeaedaaiyycqqwnypftfgggtkleikradaaptvsifppss
    eqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltlt
    kdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bt2L (L:)
    divltqspditaaslgqkvtitcsasssvsymhwyqqksgtspkpwifeisklasgvpar
    fsgsgsgtsysltissmeaedaaiyycqqwnypftfgggtkleikradaaptvsifppss
    eqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltlt
    kdeyerhnsytceathktstspivksfnrne
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >3bt2U (U:)
    rslrcmqcktngdcrveecalgqdlcrttivrlweegeelelvekscthsektnrtlsyr
    tglkitsltevvcgldlcnqgnsgravtysrsryleciscgssdmscergrhqslqcrsp
    eeqcldvvthwiqegeegrpkddrhlrgcgylpgcpgsngfhnndtfhflkccnttkcne
    gpilelenlpqngrqcysckgnsthgcsseetflidcrgpmnqclvatgthepknqsymv
    rgcatasmcqhahlgdafsmnhidvscctksgcnhpdldvqyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bt2U (U:)
    slrcmqcktngdcrveecalgqdlcrttivrlweegeelelvekscthsektnrtlsyrt
    glkitsltevvcgldlcnqgnysrsryleciscgssdmscergrhqslqcrspeeqcldv
    vthwikddrhlrgcgylpgcpgsngfhnndtfhflkccnttkcnegpilelenlpqngrq
    cysckgnsthgcsseetflidcrgpmnqclvatgthepknqsymvrgcatasmcqlgdaf
    smnhidvscctksgcnhpd