PDB entry 3bsq

View 3bsq on RCSB PDB site
Description: Crystal structure of human kallikrein 7 produced as a secretion protein in E.coli
Class: Hydrolase
Keywords: serine proteases, kallikreins, LD6, X-ray crystal structure, Glycoprotein, Hydrolase, Secreted, Zymogen
Deposited on 2007-12-26, released 2008-04-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.217
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kallikrein-7
    Species: Homo sapiens [TaxId:9606]
    Gene: KLK7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49862 (0-220)
      • expression tag (221-222)
    Domains in SCOPe 2.07: d3bsqa1, d3bsqa2
  • Chain 'B':
    Compound: Kallikrein-7
    Species: Homo sapiens [TaxId:9606]
    Gene: KLK7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49862 (0-220)
      • expression tag (221)
    Domains in SCOPe 2.07: d3bsqb1, d3bsqb2
  • Chain 'C':
    Compound: Kallikrein-7
    Species: Homo sapiens [TaxId:9606]
    Gene: KLK7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49862 (0-220)
      • expression tag (221-222)
    Domains in SCOPe 2.07: d3bsqc1, d3bsqc2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bsqA (A:)
    iidgapcargshpwqvallsgnqlhcggvlvnerwvltaahckmneytvhlgsdtlgdrr
    aqrikasksfrhpgystqthvndlmlvklnsqarlssmvkkvrlpsrceppgttctvsgw
    gtttspdvtfpsdlmcvdvklispqdctkvykdllensmlcagipdskknacngdsggpl
    vcrgtlqglvswgtfpcgqpndpgvytqvckftkwindtmkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bsqA (A:)
    iidgapcargshpwqvallsgnqlhcggvlvnerwvltaahckmneytvhlgsdtlgdrr
    aqrikasksfrhpgystqthvndlmlvklnsqarlssmvkkvrlpsrceppgttctvsgw
    gtttspdvtfpsdlmcvdvklispqdctkvykdllensmlcagipdskknacngdsggpl
    vcrgtlqglvswgtfpcgqpndpgvytqvckftkwindtmkhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3bsqB (B:)
    iidgapcargshpwqvallsgnqlhcggvlvnerwvltaahckmneytvhlgsdtlgdrr
    aqrikasksfrhpgystqthvndlmlvklnsqarlssmvkkvrlpsrceppgttctvsgw
    gtttspdvtfpsdlmcvdvklispqdctkvykdllensmlcagipdskknacngdsggpl
    vcrgtlqglvswgtfpcgqpndpgvytqvckftkwindtmkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bsqB (B:)
    iidgapcargshpwqvallsgnqlhcggvlvnerwvltaahckmneytvhlgsdtlgdrr
    aqrikasksfrhpgystqthvndlmlvklnsqarlssmvkkvrlpsrceppgttctvsgw
    gtttspdvtfpsdlmcvdvklispqdctkvykdllensmlcagipdskknacngdsggpl
    vcrgtlqglvsgtfpcgqpndpgvytqvckftkwindtmkh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3bsqC (C:)
    iidgapcargshpwqvallsgnqlhcggvlvnerwvltaahckmneytvhlgsdtlgdrr
    aqrikasksfrhpgystqthvndlmlvklnsqarlssmvkkvrlpsrceppgttctvsgw
    gtttspdvtfpsdlmcvdvklispqdctkvykdllensmlcagipdskknacngdsggpl
    vcrgtlqglvswgtfpcgqpndpgvytqvckftkwindtmkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bsqC (C:)
    iidgapcargshpwqvallsgnqlhcggvlvnerwvltaahckmneytvhlgsdtlgdrr
    aqrikasksfrhpgystqthvndlmlvklnsqarlssmvkkvrlpsrceppgttctvsgw
    gtttspdvtfpsdlmcvdvklispqdctkvykdllensmlcagipdskknacngdsggpl
    vcrgtlqglvswgtfpcgqpndpgvytqvckftkwindtmkhh