PDB entry 3bsg

View 3bsg on RCSB PDB site
Description: Barley alpha-amylase isozyme 1 (AMY1) H395A mutant
Class: Hydrolase
Keywords: barley alpha-amylase, AMY1, mutant, Calcium, Carbohydrate metabolism, Germination, Glycosidase, Hydrolase, Metal-binding, Secreted
Deposited on 2007-12-24, released 2008-08-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.211
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-amylase type A isozyme
    Species: Hordeum vulgare [TaxId:4513]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00693 (0-End)
      • see remark 999 (283)
      • engineered (394)
    Domains in SCOPe 2.06: d3bsga1, d3bsga2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bsgA (A:)
    hqvlfqgfnweswkqsggwynmmmgkvddiaaagvthvwlpppshsvsnegympgrlydi
    daskygnaaelksligalhgkgvqaiadivinhrcadykdsrgiycifeggtsdgrldwg
    phmicrddtkysdgtanldtgadfaaapdidhlndrvqrelkewllwlksdlgfdawrld
    fargyspemakvyidgtspslavaevwdnmatggdgkpnydqdahrqnlvnwvdkvggaa
    sagmvfdfttkgilnaavegelwrlidpqgkapgvmgwwpakavtfvdnhdtgstqamwp
    fpsdkvmqgyayilthpgipcifydhffnwgfkdqiaalvairkrngitatsalkilmhe
    gdayvaeidgkvvvkigsrydvgavipagfvtsaagndyavwekngaaatlqrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bsgA (A:)
    hqvlfqgfnweswkqsggwynmmmgkvddiaaagvthvwlpppshsvsnegympgrlydi
    daskygnaaelksligalhgkgvqaiadivinhrcadykdsrgiycifeggtsdgrldwg
    phmicrddtkysdgtanldtgadfaaapdidhlndrvqrelkewllwlksdlgfdawrld
    fargyspemakvyidgtspslavaevwdnmatggdgkpnydqdahrqnlvnwvdkvggaa
    sagmvfdfttkgilnaavegelwrlidpqgkapgvmgwwpakavtfvdnhdtgstqamwp
    fpsdkvmqgyayilthpgipcifydhffnwgfkdqiaalvairkrngitatsalkilmhe
    gdayvaeidgkvvvkigsrydvgavipagfvtsaagndyavwek