PDB entry 3bs3

View 3bs3 on RCSB PDB site
Description: crystal structure of a putative dna-binding protein from bacteroides fragilis
Deposited on 2007-12-21, released 2008-01-15
The last revision was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative DNA-binding protein
    Species: BACTEROIDES FRAGILIS [TaxId:272559]
    Gene: BF1076
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3bs3A (A:)
snamsnnqqmmlnrikvvlaekqrtnrwlaeqmgksentisrwcsnksqpsldmlvkvae
llnvdprqlingkiki

    Sequence, based on observed residues (ATOM records):
    >3bs3A (A:)
mmlnrikvvlaekqrtnrwlaeqmgksentisrwcsnksqpsldmlvkvaellnvdprql
in