PDB entry 3brr

View 3brr on RCSB PDB site
Description: Crystal Structure of Insulin in Complex with Sulfatide
Deposited on 2007-12-21, released 2008-12-02
The last revision was dated 2015-02-11, with a file datestamp of 2015-02-06.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.24
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: insulin
  Species: Homo sapiens [TaxId:9606]
  Gene: INS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
• Chain 'B':
  Compound: insulin
  Species: Homo sapiens [TaxId:9606]
  Gene: INS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-29)
• Chain 'C':
  Compound: insulin
  Species: Homo sapiens [TaxId:9606]
  Gene: INS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
• Chain 'D':
  Compound: insulin
  Species: Homo sapiens [TaxId:9606]
  Gene: INS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-29)
• Heterogens: ZN, SLF, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records:
  

  >3brrA (A:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records:
  

  >3brrB (B:)
  fvnqhlcgshlvealylvcgergffytpka
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records:
  

  >3brrC (C:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records:
  

  >3brrD (D:)
  fvnqhlcgshlvealylvcgergffytpka