PDB entry 3brl

View 3brl on RCSB PDB site
Description: Crystal Structure of LC8 S88E / Swa
Class: motor protein
Keywords: protein-peptide complex, Cytoplasm, Dynein, Microtubule, Motor protein, Cell cycle, Cell division, Developmental protein, Mitosis, Nucleus
Deposited on 2007-12-21, released 2008-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2008-12-30, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.194
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dynein light chain 1, cytoplasmic
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q24117 (Start-88)
      • engineered (87)
    Domains in SCOPe 2.07: d3brla_
  • Chain 'C':
    Compound: Protein swallow 10-resiude peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3brlA (A:)
msdrkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgr
nfgsyvthetrhfiyfylgqvaillfkeg

    Sequence, based on observed residues (ATOM records): (download) 
    >3brlA (A:)
sdrkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgrn
fgsyvthetrhfiyfylgqvaillfkeg

  • Chain 'C':
    No sequence available.