PDB entry 3brf

View 3brf on RCSB PDB site
Description: CSL (Lag-1) bound to DNA with Lin-12 RAM peptide, C2221
Class: DNA binding protein/DNA
Keywords: protein-DNA complex, signaling, transcription, Notch, DNA-binding, ANK repeat, Developmental protein, Differentiation, EGF-like domain, Glycoprotein, Membrane, Transmembrane, DNA BINDING PROTEIN-DNA COMPLEX
Deposited on 2007-12-21, released 2008-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.47 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lin-12 and glp-1 phenotype protein 1, isoform a
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: LAG-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3brfa1, d3brfa2, d3brfa3
  • Chain 'B':
    Compound: DNA (5'-d(*dtp*dtp*dap*dcp*dtp*dgp*dtp*dgp*dgp*dgp*dap*dap*dap*dgp*da)-3')
  • Chain 'C':
    Compound: DNA (5'-d(*dap*dap*dtp*dcp*dtp*dtp*dtp*dcp*dcp*dcp*dap*dcp*dap*dgp*dt)-3')
  • Chain 'D':
    Compound: Protein lin-12
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: lin-12
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SOR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3brfA (A:)
    sgplgsgdsvqsltsdrmidflsnkekyecvisifhakvaqksygnekrffcpppciyli
    gqgwklkkdrvaqlyktlkasaqkdaaiendpiheqqatelvayigigsdtserqqldfs
    tgkvrhpgdqrqdpniydycaaktlyisdsdkrkyfdlnaqffygcgmeiggfvsqrikv
    iskpskkkqsmkntdckylciasgtkvalfnrlrsqtvstrylhvegnafhasstkwgaf
    tihlfdderglqetdnfavrdgfvyygsvvklvdsvtgialprlrirkvdkqqvildasc
    seepvsqlhkcafqmidnelvylclshdkiiqhqatainehrhqindgaawtiistdkae
    yrffeamgqvanpispcpvvgslevdghgeasrvelhgrdfkpnlkvwfgatpvettfrs
    eeslhcsippvsqvrneqthwmftnrttgdvevpislvrddgvvyssgltfsyksler
    

    Sequence, based on observed residues (ATOM records): (download)
    >3brfA (A:)
    sltsdrmidflsnkekyecvisifhakvaqksygnekrffcpppciyligqgwklkkdrv
    aqlyktltelvayigigsdtserqqldfpniydycaaktlyisdsdkrkyfdlnaqffyg
    cgmeiggfvsqrikviskpskkkqsdckylciasgtkvalfnrlrsqtvstrylhvegna
    fhasstkwgaftihlfddeqetdnfavrdgfvyygsvvklvdsvtgialprlrirkvdkq
    qvildascseepvsqlhkcafqmidnelvylclshdkiiqhqatainehrhqindgaawt
    iistdkaeyrffeamgqvanpispcpvvgslevdghgeasrvelhgrdfkpnlkvwfgat
    pvettfrseeslhcsippvsqvrneqthwmftnrttgdvevpislvrddgvvyssgltfs
    yks
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.