PDB entry 3bqx

View 3bqx on RCSB PDB site
Description: high resolution crystal structure of a glyoxalase-related enzyme from fulvimarina pelagi
Deposited on 2007-12-20, released 2008-01-08
The last revision was dated 2021-02-03, with a file datestamp of 2021-01-29.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glyoxalase-related enzyme
    Species: Fulvimarina pelagi [TaxId:314231]
    Gene: FP2506_05986
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0G7J9 (3-End)
      • expression tag (2)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3bqxA (A:)
mslqqvavitlgigdleasarfygegfgwapvfrnpeiifyqmngfvlatwlvqnlqedv
gvavtsrpgsmalahnvraetevaplmerlvaaggqllrpadapphgglrgyvadpdghi
weiafnpvwpigadgsvtfaakeghhhhhh

    Sequence, based on observed residues (ATOM records):
    >3bqxA (A:)
lqqvavitlgigdleasarfygegfgwapvfrnpeiifyqmngfvlatwlvqnlqedvgv
avtsrpgsmalahnvraetevaplmerlvaaggqllrpadapphgglrgyvadpdghiwe
iafnpvwpigadgsvtfaa