PDB entry 3bqp

View 3bqp on RCSB PDB site
Description: Crystal Structure of Human Saposin D (orthorhombic)
Class: lipid binding protein
Keywords: saposin, sphingolipid activator protein, lipid binding protein, acid ceramidase,farber disease, lipid metabolism, lysosome, sphingolipid metabolism
Deposited on 2007-12-20, released 2008-02-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.177
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Proactivator polypeptide
  Species: Homo sapiens [TaxId:9606]
  Gene: PSAP;
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07602 (0-79)
  Domains in SCOPe 2.08: d3bqpa_
• Chain 'B':
  Compound: Proactivator polypeptide
  Species: Homo sapiens [TaxId:9606]
  Gene: PSAP;
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07602 (0-79)
  Domains in SCOPe 2.08: d3bqpb_
• Heterogens: MG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3bqpA (A:)
  dggfcevckklvgyldrnleknstkqeilaalekgcsflpdpyqkqcdqfvaeyepvlie
  ilvevmdpsfvclkigacps
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3bqpB (B:)
  dggfcevckklvgyldrnleknstkqeilaalekgcsflpdpyqkqcdqfvaeyepvlie
  ilvevmdpsfvclkigacps