PDB entry 3bqo

View 3bqo on RCSB PDB site
Description: Crystal Structure of TRF1 TRFH domain and TIN2 peptide complex
Class: DNA binding protein
Keywords: TRF1 TRFH domain Dimerization domain TIN2, ADP-ribosylation, Alternative splicing, Cell cycle, Cell division, Chromosomal protein, DNA-binding, Mitosis, Nucleus, Phosphoprotein, Telomere, DNA BINDING PROTEIN
Deposited on 2007-12-20, released 2008-02-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.22
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Telomeric repeat-binding factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TERF1, PIN2, TRBF1, TRF, TRF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3bqoa_
  • Chain 'B':
    Compound: TERF1-interacting nuclear factor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: TINF2, TIN2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BSI4 (1-End)
      • see remark 999 (0)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bqoA (A:)
    eeeeedaglvaeaeavaagwmldflclslcrafrdgrsedfrrtrnsaeaiihglsslta
    cqlrtiyicqfltriaagktldaqfenderitplesalmiwgsiekehdklheeiqnlik
    iqaiavcmengnfkeaeevferifgdpnshmpfkskllmiisqkdtfhsffqhfsynhmm
    ekiksyvnyvlseksstflmkaaakvveskr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bqoA (A:)
    edaglvaeaeavaagwmldflclslcrafrdgrsedfrrtrnsaeaiihglssltacqlr
    tiyicqfltriaagktldaqfenderitplesalmiwgsiekehdklheeiqnlikiqai
    avcmengnfkeaeevferifhmpfkskllmiisqkdtfhsffqhfsynhmmekiksyvny
    vlseksstflmkaaakvveskr
    

  • Chain 'B':
    No sequence available.