PDB entry 3bpc

View 3bpc on RCSB PDB site
Description: co-crystal structure of S25-2 Fab in complex with 5-deoxy-4-epi-2,3-dehydro Kdo (4.8) Kdo
Class: immune system
Keywords: Fab, anti-carbohydrate antibody, IMMUNE SYSTEM
Deposited on 2007-12-18, released 2009-01-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-01-13, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.226
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab, antibody fragment (IgG1k), light chain
    Species: MUS MUSCULUS
    Domains in SCOPe 2.05: d3bpca1, d3bpca2
  • Chain 'B':
    Compound: Fab, antibody fragment (IgG1k), heavy chain
    Species: MUS MUSCULUS
    Domains in SCOPe 2.05: d3bpcb1, d3bpcb2
  • Heterogens: KDA, ZN, MG, KDB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bpcA (A:)
    divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltitsvqaedlavyyckqsynlrtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bpcA (A:)
    divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltitsvqaedlavyyckqsynlrtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgsegvlnswtdqdskdstysmsst
    ltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3bpcB (B:)
    evklvesggglvqsggslrlscatsgftftdyymswvrqppgkalewlgfirnkangytt
    eyspsvkgrftisrdnsqsilylqmntlraedsatyycardhdgyyerfsywgqgtlvtv
    saakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlq
    sdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bpcB (B:)
    evklvesggglvqsggslrlscatsgftftdyymswvrqppgkalewlgfirnkangytt
    eyspsvkgrftisrdnsqsilylqmntlraedsatyycardhdgyyerfsywgqgtlvtv
    saakttppsvyplapsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
    ssvtvpsstwpsetvtcnvahpasstkvdkkivp