PDB entry 3bpb

View 3bpb on RCSB PDB site
Description: Crystal structure of the dimethylarginine dimethylaminohydrolase H162G adduct with S-methyl-L-thiocitrulline
Class: hydrolase
Keywords: enzyme adduct, HYDROLASE
Deposited on 2007-12-18, released 2008-06-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.81 Å
R-factor: 0.233
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dimethylarginine dimethylaminohydrolase
    Species: PSEUDOMONAS AERUGINOSA
    Gene: PA1195
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I4E3 (0-253)
      • engineered (161)
    Domains in SCOPe 2.06: d3bpba_
  • Chain 'B':
    Compound: dimethylarginine dimethylaminohydrolase
    Species: PSEUDOMONAS AERUGINOSA
    Gene: PA1195
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I4E3 (0-253)
      • engineered (161)
    Domains in SCOPe 2.06: d3bpbb_
  • Heterogens: SMZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bpbA (A:)
    mfkhiiartparslvdgltsshlgkpdyakaleqhnayiralqtcdvditllppderfpd
    svfvedpvlctsrcaiitrpgaesrrgeteiieetvqrfypgkverieapgtveagdimm
    vgdhfyigesartnaegarqmiailekhglsgsvvrlekvlglktglaylehnnllaage
    fvskpefqdfniieipeeesyaanciwvnervimpagyprtrekiarlgyrvievdtsey
    rkidggvscmslrf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bpbB (B:)
    mfkhiiartparslvdgltsshlgkpdyakaleqhnayiralqtcdvditllppderfpd
    svfvedpvlctsrcaiitrpgaesrrgeteiieetvqrfypgkverieapgtveagdimm
    vgdhfyigesartnaegarqmiailekhglsgsvvrlekvlglktglaylehnnllaage
    fvskpefqdfniieipeeesyaanciwvnervimpagyprtrekiarlgyrvievdtsey
    rkidggvscmslrf