PDB entry 3bp8

View 3bp8 on RCSB PDB site
Description: Crystal structure of Mlc/EIIB complex
Class: transcription
Keywords: enzyme, IICBGlc, glucose signaling, Mlc, protein-protein interaction, transcription regulation, Inner membrane, Kinase, Membrane, Phosphoprotein, Phosphotransferase system, Sugar transport, Transferase, Transmembrane, Transport
Deposited on 2007-12-18, released 2008-05-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.228
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative NAGC-like transcriptional regulator
    Species: Escherichia coli
    Gene: mlc
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3bp8a1, d3bp8a2, d3bp8a3
  • Chain 'B':
    Compound: Putative NAGC-like transcriptional regulator
    Species: Escherichia coli
    Gene: mlc
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3bp8b1, d3bp8b2, d3bp8b3
  • Chain 'C':
    Compound: PTS system glucose-specific EIICB component
    Species: Escherichia coli
    Gene: ptsG, glcA, umg
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3bp8c_
  • Chain 'D':
    Compound: PTS system glucose-specific EIICB component
    Species: Escherichia coli
    Gene: ptsG, glcA, umg
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3bp8d_
  • Heterogens: ACT, ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bp8A (A:)
    mvaenqpghidqikqtnagavyrlidqlgpvsridlsrlaqlapasitkivremleahlv
    qeleikeagnrgrpavglvveteawhylslrisrgeiflalrdlssklvveesqelalkd
    dsplldriishidqffirhqkklerltsiaitlpgiidtengivhrmpfyedvkemplge
    aleqhtgvpvyiqhdisawtmaealfgasrgardviqvvidhnvgagvitdghllhagss
    slveightqvdpygkrcycgnhgcletiasvdsilelaqlrlnqsmssmlhgqpltvdsl
    cqaalrgdllakdiitgvgahvgrilaimvnlfnpqkiligsplskaadilfpvisdsir
    qqalpaysqhisvestqfsnqgtmagaalvkdamyngsllirllqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bp8A (A:)
    dqikqtnagavyrlidqlgpvsridlsrlaqlapasitkivremleahlvqelevglvve
    teawhylslrisrgeiflalrdlssklvveesqelalkddsplldriishidqffirhqk
    klerltsiaitlpgiidtengivhrmpfyedvkemplgealeqhtgvpvyiqhdisawtm
    aealfgasrgardviqvvidhnvgagvitdghllhagssslveightqvdpygkrcycgn
    hgcletiasvdsilelaqlrlnqsmhgqpltvdslcqaalrgdllakdiitgvgahvgri
    laimvnlfnpqkiligsplskaadilfpvisdsirqqalpaysqhisvestqfsnqgtma
    gaalvkdamyngsllirllqg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3bp8B (B:)
    mvaenqpghidqikqtnagavyrlidqlgpvsridlsrlaqlapasitkivremleahlv
    qeleikeagnrgrpavglvveteawhylslrisrgeiflalrdlssklvveesqelalkd
    dsplldriishidqffirhqkklerltsiaitlpgiidtengivhrmpfyedvkemplge
    aleqhtgvpvyiqhdisawtmaealfgasrgardviqvvidhnvgagvitdghllhagss
    slveightqvdpygkrcycgnhgcletiasvdsilelaqlrlnqsmssmlhgqpltvdsl
    cqaalrgdllakdiitgvgahvgrilaimvnlfnpqkiligsplskaadilfpvisdsir
    qqalpaysqhisvestqfsnqgtmagaalvkdamyngsllirllqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bp8B (B:)
    qikqtnagavyrlidqlgpvsridlsrlaqlapasitkivremleahlvqelvglvvete
    awhylslrisrgeiflalrdlssklvveesqelalkddsplldriishidqffirhqkkl
    erltsiaitlpgiidtengivhrmpfyedvkemplgealeqhtgvpvyiqhdisawtmae
    alfgasrgardviqvvidhnvgagvitdghllhagssslveightqvdpygkrcycgnhg
    cletiasvdsilelaqlrlnqsmssmlhgqpltvdslcqaalrgdllakdiitgvgahvg
    rilaimvnlfnpqkiligsplskaadilfpvisdsirqqalpaysqhisvestqfsnmag
    aalvkdamyngsllirllqg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bp8C (C:)
    mapalvaafggkenitnldacitrlrvsvadvskvdqaglkklgaagvvvagsgvqaifg
    tksdnlktemdeyir
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bp8D (D:)
    mapalvaafggkenitnldacitrlrvsvadvskvdqaglkklgaagvvvagsgvqaifg
    tksdnlktemdeyir