PDB entry 3bp5

View 3bp5 on RCSB PDB site
Description: Crystal structure of the mouse PD-1 and PD-L2 complex
Class: signaling protein
Keywords: PD-1, PD-L2, Complex, Costimulation, Glycoprotein, Immunoglobulin domain, Membrane, Transmembrane, Receptor, SIGNALING PROTEIN
Deposited on 2007-12-18, released 2008-07-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Programmed cell death protein 1
    Species: MUS MUSCULUS
    Gene: Pdcd1, Pd1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02242 (0-End)
      • engineered (49)
    Domains in SCOPe 2.08: d3bp5a_
  • Chain 'B':
    Compound: Programmed cell death 1 ligand 2
    Species: MUS MUSCULUS
    Gene: Pdcd1lg2, B7dc, Btdc, Cd273, Pdl2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WUL5 (1-End)
      • expression tag (0)
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bp5A (A:)
    sltfypawltvseganatftcslsnwsedlmlnwnrlspsnqtekqaafsnglsqpvqda
    rfqiiqlpnrhdfhmnildtrrndsgiylcgaislhpkakieespgaelvvterile
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bp5A (A:)
    sltfypawltvseganatftcslsnwsedlmlnwnrlspsnqtekqaafsnglsqpvqda
    rfqiiqlpnrhdfhmnildtrrndsgiylcgaislhpkakieespgaelvvter
    

  • Chain 'B':
    No sequence available.