PDB entry 3bp3

View 3bp3 on RCSB PDB site
Description: Crystal structure of EIIB
Class: transferase
Keywords: transcription regulation, Inner membrane, Kinase, Membrane, Phosphoprotein, Phosphotransferase system, Sugar transport, Transferase, Transmembrane, Transport
Deposited on 2007-12-18, released 2008-11-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.213
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucose-specific phosphotransferase enzyme IIB component
    Species: Escherichia coli [TaxId:562]
    Gene: ptsG, glcA, umg
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3bp3a_
  • Chain 'B':
    Compound: Glucose-specific phosphotransferase enzyme IIB component
    Species: Escherichia coli [TaxId:562]
    Gene: ptsG, glcA, umg
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3bp3b_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bp3A (A:)
    tgtsemapalvaafggkenitnldacitrlrvsvadvskvdqaglkklgaagvvvagsgv
    qaifgtksdnlktemdeyirnh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bp3A (A:)
    tgtsemapalvaafggkenitnldacitrlrvsvadvskvdqaglkklgaagvvvagsgv
    qaifgtksdnlktemdeyirn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3bp3B (B:)
    tgtsemapalvaafggkenitnldacitrlrvsvadvskvdqaglkklgaagvvvagsgv
    qaifgtksdnlktemdeyirnh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bp3B (B:)
    tgtsemapalvaafggkenitnldacitrlrvsvadvskvdqaglkklgaagvvvagsgv
    qaifgtksdnlktemdeyirn