PDB entry 3bp2

View 3bp2 on RCSB PDB site
Description: role of the n-terminus in the interaction of pancreatic phospholipase a2 with aggregated substrates. properties and crystal structure of transaminated phospholipase a2
Class: carboxylic ester hydrolase
Keywords: carboxylic ester hydrolase
Deposited on 1983-06-27, released 1983-09-15
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.174
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Bos taurus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3bp2a_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bp2A (A:)
    xlwqfngmikckipsseplldfnnygcycglggsgtpvddldrccqthdncykqakklds
    ckvlvdnpytnnysyscsnneitcssennaceaficncdrnaaicfskvpynkehknldk
    knc