PDB entry 3boy

View 3boy on RCSB PDB site
Description: Crystal structure of the HutP antitermination complex bound to the HUT mRNA
Class: transcription/RNA
Keywords: HutP, RNA-binding, HutP-RNA Complex, Anti-termination, Transcription regulation, Activator, Histidine metabolism, TRANSCRIPTION/RNA COMPLEX, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-12-18, released 2008-01-15
The last revision prior to the SCOP 1.75 freeze date was dated 2008-01-15, with a file datestamp of 2008-01-11.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.2
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Hut operon positive regulatory protein
  Species: Bacillus subtilis
  Gene: hutP
  Database cross-references and differences (RAF-indexed):
  • Uniprot P10943 (0-146)
    • engineered (49)
  Domains in SCOP 1.75: d3boya1
• Chain 'B':
  Compound: Hut operon positive regulatory protein
  Species: Bacillus subtilis
  Gene: hutP
  Database cross-references and differences (RAF-indexed):
  • Uniprot P10943 (0-146)
    • engineered (49)
  Domains in SCOP 1.75: d3boyb1
• Chain 'C':
  Compound: Hut operon positive regulatory protein
  Species: Bacillus subtilis
  Gene: hutP
  Database cross-references and differences (RAF-indexed):
  • Uniprot P10943 (0-146)
    • engineered (49)
  Domains in SCOP 1.75: d3boyc1
• Chain 'D':
  Compound: 5'-r(*up*up*up*ap*gp*up*up*up*up*up*ap*gp*up*up*up*up*up*ap*gp*up*up*u)-3'
  
• Heterogens: MG, HIS, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3boyA (A:)
  tlhkerrigrlsvllllneaeestqveelerdgwkvclgkvgsmdahkviaaietaskks
  gviqsegyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwi
  avslygtigapikglehetfgvginhi
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3boyB (B:)
  tlhkerrigrlsvllllneaeestqveelerdgwkvclgkvgsmdahkviaaietaskks
  gviqsegyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwi
  avslygtigapikglehetfgvginhi
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3boyC (C:)
  tlhkerrigrlsvllllneaeestqveelerdgwkvclgkvgsmdahkviaaietaskks
  gviqsegyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwi
  avslygtigapikglehetfgvginhi
  

  
  
• Chain 'D':
  No sequence available.