PDB entry 3bov

View 3bov on RCSB PDB site
Description: Crystal structure of the receptor binding domain of mouse PD-L2
Class: immune system
Keywords: PD-L2; B7-DC, Programmed death-1 Ligand2, Glycoprotein, Immunoglobulin domain, Membrane, Receptor, Transmembrane, IMMUNE SYSTEM
Deposited on 2007-12-17, released 2008-07-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Programmed cell death 1 ligand 2
    Species: MUS MUSCULUS
    Gene: Pdcd1lg2, B7dc, Btdc, Cd273, Pdl2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3bova_
  • Heterogens: NA, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bovA (A:)
    mlftvtapkevytvdvgssvslecdfdrrectelegiraslqkvendtslqseratllee
    qlplgkalfhipsvqvrdsgqyrclvicgaawdykyltvkvkasy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bovA (A:)
    lftvtapkevytvdvgssvslecdfdrrectelegiraslqkvendtslqseratlleeq
    lplgkalfhipsvqvrdsgqyrclvicgaawdykyltvkvkasy