PDB entry 3bom

View 3bom on RCSB PDB site
Description: Crystal structure of trout hemoglobin at 1.35 Angstrom resolution
Class: oxygen storage/transport
Keywords: Fish Hemoglobin, Structural Genomics Community Request, Protein Structure Initiative, PSI-2, Center for Eukaryotic Structural Genomics, CESG, Heme, Iron, Metal-binding, Oxygen transport, Transport, OXYGEN STORAGE/TRANSPORT, OXYGEN STORAGE-TRANSPORT complex
Deposited on 2007-12-17, released 2008-01-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-01-23, with a file datestamp of 2013-01-18.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.172
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemoglobin subunit alpha-4
    Species: Oncorhynchus mykiss [TaxId:8022]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3boma_
  • Chain 'B':
    Compound: Hemoglobin subunit beta-4
    Species: Oncorhynchus mykiss [TaxId:8022]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02141 (0-146)
      • conflict (5)
      • conflict (85-86)
      • conflict (96)
    Domains in SCOPe 2.04: d3bomb_
  • Chain 'C':
    Compound: Hemoglobin subunit alpha-4
    Species: Oncorhynchus mykiss [TaxId:8022]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3bomc_
  • Chain 'D':
    Compound: Hemoglobin subunit beta-4
    Species: Oncorhynchus mykiss [TaxId:8022]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02141 (0-146)
      • conflict (5)
      • conflict (85-86)
      • conflict (96)
    Domains in SCOPe 2.04: d3bomd_
  • Heterogens: HEM, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bomA (A:)
    slsakdkanvkaiwgkilpksdeigeqalsrmlvvypqtkayfshwasvapgsapvkkhg
    itimnqiddcvghmddlfgfltklselhatklrvdptnfkilahnlivviaayfpaeftp
    eihlsvdkflqqlalalaekyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bomB (B:)
    vdwtdaersaivglwgkisvdeigpqalarllivspwtqrhfstfgnlstpaaimgnpav
    akhgktvmhgldravqnlddikntyvtlsvmhseklfvdpdnfrlladcitvcvaaklgp
    avfsadtqeafqkflavvvsalgrqyh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bomC (C:)
    slsakdkanvkaiwgkilpksdeigeqalsrmlvvypqtkayfshwasvapgsapvkkhg
    itimnqiddcvghmddlfgfltklselhatklrvdptnfkilahnlivviaayfpaeftp
    eihlsvdkflqqlalalaekyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bomD (D:)
    vdwtdaersaivglwgkisvdeigpqalarllivspwtqrhfstfgnlstpaaimgnpav
    akhgktvmhgldravqnlddikntyvtlsvmhseklfvdpdnfrlladcitvcvaaklgp
    avfsadtqeafqkflavvvsalgrqyh