PDB entry 3bol

View 3bol on RCSB PDB site
Description: Cobalamin-dependent methionine synthase (1-566) from Thermotoga maritima complexed with Zn2+
Class: transferase
Keywords: MetH, TRANSFERASE, TIM BARREL, ZINC, ZINC INVERSION, Methyltransferase
Deposited on 2007-12-17, released 2008-03-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.193
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5-methyltetrahydrofolate S-homocysteine methyltransferase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3bola1, d3bola2
  • Chain 'B':
    Compound: 5-methyltetrahydrofolate S-homocysteine methyltransferase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3bolb1, d3bolb2
  • Heterogens: ZN, K, YT3, HCS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bolA (A:)
    mrnrrevskllservllldgaygtefmkygyddlpeelnikapdvvlkvhrsyiesgsdv
    iltntfgatrmklrkhgledkldpivrnavriarraageklvfgdigptgelpyplgstl
    feefyenfretveimveegvdgiifetfsdilelkaavlaarevsrdvfliahmtfdekg
    rsltgtdpanfaitfdeldidalgincslgpeeilpifqelsqytdkflvvepnagkpiv
    engktvyplkphdfavhidsyyelgvnifggccgttpehvklfrkvlgnrkplqrkkkri
    favsspsklvtfdhfvvigerinpagrkklwaemqkgneeivikeaktqvekgaevldvn
    fgiesqidvryvekivqtlpyvsnvplsldiqnvdlteralraypgrslfnsakvdeeel
    emkinllkkyggtlivllmgkdvpksfeerkeyfekalkilerhdfsdrvifdpgvlplg
    aegkpvevlktiefisskgfnttvglsnlsfglpdrsyyntaflvlgiskglssaimnpl
    detlmktlnatlvilekkelpraevk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bolA (A:)
    mrnrrevskllservllldgaygtefmkygyddlpeelnikapdvvlkvhrsyiesgsdv
    iltntfgatrmklrkhgledkldpivrnavriarraageklvfgdigptgelpyplgstl
    feefyenfretveimveegvdgiifetfsdilelkaavlaarevsrdvfliahmtfdekg
    rsltgtdpanfaitfdeldidalgincslgpeeilpifqelsqytdkflvvepnagkpiv
    engktvyplkphdfavhidsyyelgvnifggccgttpehvklfrkvlgnrkplqrkkkri
    favsspsklvtfdhfvvigerinpagrkklwaemqkgneeivikeaktqvekgaevldvn
    fgiesqidvryvekivqtlpyvsnvplsldiqnvdlteralraypgrslfnsakvdeeel
    emkinllkkyggtlivllmgkdvpksfeerkeyfekalkilerhdfsdrvifdpgvlplg
    aegkpvevlktiefisskgfnttvglsnlsflpdrsyyntaflvlgiskglssaimnpld
    etlmktlnatlvilekk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3bolB (B:)
    mrnrrevskllservllldgaygtefmkygyddlpeelnikapdvvlkvhrsyiesgsdv
    iltntfgatrmklrkhgledkldpivrnavriarraageklvfgdigptgelpyplgstl
    feefyenfretveimveegvdgiifetfsdilelkaavlaarevsrdvfliahmtfdekg
    rsltgtdpanfaitfdeldidalgincslgpeeilpifqelsqytdkflvvepnagkpiv
    engktvyplkphdfavhidsyyelgvnifggccgttpehvklfrkvlgnrkplqrkkkri
    favsspsklvtfdhfvvigerinpagrkklwaemqkgneeivikeaktqvekgaevldvn
    fgiesqidvryvekivqtlpyvsnvplsldiqnvdlteralraypgrslfnsakvdeeel
    emkinllkkyggtlivllmgkdvpksfeerkeyfekalkilerhdfsdrvifdpgvlplg
    aegkpvevlktiefisskgfnttvglsnlsfglpdrsyyntaflvlgiskglssaimnpl
    detlmktlnatlvilekkelpraevk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bolB (B:)
    mrnrrevskllservllldgaygtefmkygyddlpeelnikapdvvlkvhrsyiesgsdv
    iltntfgatrmklrkhgledkldpivrnavriarraageklvfgdigptgelpyplgstl
    feefyenfretveimveegvdgiifetfsdilelkaavlaarevsrdvfliahmtfdekg
    rsltgtdpanfaitfdeldidalgincslgpeeilpifqelsqytdkflvvepnagyplk
    phdfavhidsyyelgvnifggccgttpehvklfrkvlgnrkplqrkkkrifavsspsklv
    tfdhfvvigerinpagrkklwaemqkgneeivikeaktqvekgaevldvnfgiesqidvr
    yvekivqtlpyvsnvplsldiqnvdlteralraypgrslfnsakvdeeelemkinllkky
    ggtlivllmgkdvpksfeerkeyfekalkilerhdfsdrvifdpgvlplgaegkpvevlk
    tiefisskgfnttvglsnlsflpdrsyyntaflvlgiskglssaimnpldetlmktlnat
    lvilekkel