PDB entry 3bod

View 3bod on RCSB PDB site
Description: Structure of mouse beta-neurexin 1
Class: cell adhesion
Keywords: Neurexin1D, LNS6, Alternative splicing, Calcium, Cell adhesion, EGF-like domain, Glycoprotein, Membrane, Metal-binding, Transmembrane
Deposited on 2007-12-17, released 2008-03-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-08-02, with a file datestamp of 2017-07-28.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Neurexin-1-alpha
  Species: Mus musculus [TaxId:10090]
  Gene: Nrxn1, Kiaa0578
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9CS84 (5-119)
    • expression tag (0-4)
  • Uniprot Q9CS84 (120-177)
  Domains in SCOPe 2.08: d3boda1, d3boda2
• Heterogens: CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3bodA (A:)
  aplgstyifskgggqitykwppndrpstradrlaigfstvqkeavlvrvdsssglgdyle
  lhihqgkigvkfnvgtddiaieesnaiindgkyhvvrftrsggnatlqvdswpvierypa
  grqltifnsqatiiiggkeqgqpfqgqlsglyynglkvlnmaaendaniaivgnvrlv