PDB entry 3bo2

View 3bo2 on RCSB PDB site
Description: A relaxed active site following exon ligation by a group I intron
Class: nuclear protein/RNA
Keywords: group I intron, azoarcus, ribozyme, ligation, Acetylation, mRNA processing, mRNA splicing, Nucleus, Ribonucleoprotein, RNA-binding, Spliceosome, NUCLEAR PROTEIN-RNA COMPLEX
Deposited on 2007-12-17, released 2008-04-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 3.31 Å
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: U1 small nuclear ribonucleoprotein A
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P09012 (0-94)
    • engineered (27)
    • engineered (32)
  Domains in SCOPe 2.08: d3bo2a1
• Chain 'B':
  Compound: Group I intron P9
  Species: synthetic construct, synthetic [TaxId:32630]
  
• Chain 'C':
  Compound: RNA (5'-r(*ap*ap*gp*cp*cp*ap*cp*ap*cp*ap*ap*ap*cp*cp*ap*g)-3')
  Species: synthetic construct, synthetic [TaxId:32630]
  
• Chain 'D':
  Compound: RNA (5'-r(*ap*cp*gp*gp*cp*c)-3')
  Species: synthetic construct, synthetic [TaxId:32630]
  
• Chain 'E':
  Compound: RNA (5'-r(*cp*ap*u)-3')
  Species: synthetic construct, synthetic [TaxId:32630]
  
• Heterogens: MG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3bo2A (A:)
  petrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevs
  satnalrsmqgfpfydkpmriqyaktdsdiiakmk
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.