PDB entry 3bnf

View 3bnf on RCSB PDB site
Description: W. succinogenes NrfA Sulfite Complex
Class: oxidoreductase
Keywords: c-type cytochrome, nitrite reductase, sulfite complex, Calcium, Electron transport, Heme, Iron, Metal-binding, Oxidoreductase, Periplasm, Transport
Deposited on 2007-12-14, released 2008-02-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.235
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c-552
    Species: Wolinella succinogenes [TaxId:844]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3bnfa_
  • Heterogens: CA, SO3, Y1, ACT, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bnfA (A:)
    sninerekervalnktahsqgiegkamseewaryyprqfdswkktkesdnitdmlkekpa
    lvvawagypfskdynaprghyyalqdnintlrtgapvdgktgplpsacwtckspdvprii
    eqdgeleyftgkwakygdeivntigcynchddksaelkskvpyldrglsaagfktfaest
    hqekrslvcaqchveyyfkktewkddkgvdktamvvtlpwskgisteqmeayydeinfad
    wthgisktpmlkaqhpdwelyktgihgqkgvscadchmpytqegavkysdhkvgnpldnm
    dkscmnchreseqklkdivkqkferkeflqdiafdnigkahletgkamelgatdaelkei
    rthirhaqwradmaiaghgsffhapeevlrllasgneeaqkariklvkvlakygaidyva
    pdfetkekaqklakvdmeafiaeklkfkqtleqewkkqaiakgrlnpeslkgvdekssyy
    dktkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bnfA (A:)
    ktahsqgiegkamseewaryyprqfdswkktkesdnitdmlkekpalvvawagypfskdy
    naprghyyalqdnintlrtgapvdgktgplpsacwtckspdvpriieqdgeleyftgkwa
    kygdeivntigcynchddksaelkskvpyldrglsaagfktfaesthqekrslvcaqchv
    eyyfkktewkddkgvdktamvvtlpwskgisteqmeayydeinfadwthgisktpmlkaq
    hpdwelyktgihgqkgvscadchmpytqegavkysdhkvgnpldnmdkscmnchreseqk
    lkdivkqkferkeflqdiafdnigkahletgkamelgatdaelkeirthirhaqwradma
    iaghgsffhapeevlrllasgneeaqkariklvkvlakygaidyvapdfetkekaqklak
    vdmeafiaeklkfkqtleqewkkqaiakgrlnpeslkgvdekssyydktkk