PDB entry 3bne

View 3bne on RCSB PDB site
Description: Lipoxygenase-1 (Soybean) I553A Mutant
Class: oxidoreductase
Keywords: DIOXYGENASE, LIPOXYGENASE, METALLOPROTEIN, FATTY ACIDS, Fatty acid biosynthesis, Iron, Lipid synthesis, Metal-binding, Oxidoreductase, Oxylipin biosynthesis, ----
Deposited on 2007-12-14, released 2008-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.167
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: seed lipoxygenase-1
    Species: Glycine max [TaxId:3847]
    Gene: LOX1.1, LOX1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08170 (Start-838)
      • engineered (159)
      • engineered (552)
    Domains in SCOPe 2.07: d3bnea1, d3bnea2
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bneA (A:)
    mfsaghkikgtvvlmpknelevnpdgsavdnlnaflgrsvslqlisatkadahgkgkvgk
    dtflegintslptlgagesafnihfewdgsmgipgafyiknymqvefflksltleaisnq
    gtirfvcnswvyntklyksvriffanhtyvpsetpaplveyreeelkslrgngtgerkey
    driydydvyndlgnpdkseklarpvlggsstfpyprrgrtgrgptvtdpntekqgevfyv
    prdenlghlkskdaleigtkslsqivqpafesafdlkstpiefhsfqdvhdlyeggiklp
    rdvistiiplpvikelyrtdgqhilkfpqphvvqvsqsawmtdeefaremiagvnpcvir
    gleefppksnldpaiygdqsskitadsldldgytmdealgsrrlfmldyhdifmpyvrqi
    nqlnsaktyatrtilflredgtlkpvaielslphsagdlsaavsqvvlpakegvestiwl
    lakayvivndscyhqlmshwlnthaamepfviathrhlsvlhpiyklltphyrnnmnina
    larqslinangiaettflpskysvemssavyknwvftdqalpadlikrgvaikdpstphg
    vrlliedypyaadgleiwaaiktwvqeyvplyyardddvkndselqhwwkeavekghgdl
    kdkpwwpklqtledlvevcliiiwiasalhaavnfgqypygglimnrptasrrllpekgt
    peyeeminnhekaylrtitsklptlislsvieilsthasdevylgqrdnphwtsdskalq
    afqkfgnklkeieeklvrrnndpslqgnrlgpvqlpytllypsseegltfrgipnsisi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bneA (A:)
    kikgtvvlmpknenlnaflgrsvslqlisatkadahgkgkvgkdtflegintslptlgag
    esafnihfewdgsmgipgafyiknymqvefflksltleaitirfvcnswvyntklyksvr
    iffanhtyvpsetpaplveyreeelkslrgngtgerkeydriydydvyndlgnpdksekl
    arpvlggsstfpyprrgrtgrgptvtdpntekqgevfyvprdenlghlkskdaleigtks
    lsqivqpafesafdlkstpiefhsfqdvhdlyeggiklprdvistiiplpvikelyrtdg
    qhilkfpqphvvqvsqsawmtdeefaremiagvnpcvirgleefppksnldpaiygdqss
    kitadsldldgytmdealgsrrlfmldyhdifmpyvrqinqlnsaktyatrtilflredg
    tlkpvaielslphsagdlsaavsqvvlpakegvestiwllakayvivndscyhqlmshwl
    nthaamepfviathrhlsvlhpiyklltphyrnnmninalarqslinangiaettflpsk
    ysvemssavyknwvftdqalpadlikrgvaikdpstphgvrlliedypyaadgleiwaai
    ktwvqeyvplyyardddvkndselqhwwkeavekghgdlkdkpwwpklqtledlvevcli
    iiwiasalhaavnfgqypygglimnrptasrrllpekgtpeyeeminnhekaylrtitsk
    lptlislsvieilsthasdevylgqrdnphwtsdskalqafqkfgnklkeieeklvrrnn
    dpslqgnrlgpvqlpytllypsseegltfrgipnsisi